LOCUS       EF622045                 618 bp    mRNA    linear   INV 31-OCT-2008
DEFINITION  Radopholus similis FMRFamide-like peptide 11 (flp-11) mRNA,
            complete cds.
ACCESSION   EF622045
VERSION     EF622045.1  GI:156753304
KEYWORDS    .
SOURCE      Radopholus similis
  ORGANISM  Radopholus similis
            Eukaryota; Metazoa; Nematoda; Chromadorea; Tylenchida; Tylenchina;
            Tylenchoidea; Pratylenchidae; Radopholinae; Radopholus.
REFERENCE   1  (bases 1 to 618)
  AUTHORS   Xiao,L., Xie,B.Y., Dai,L.Y. and Xiao,Q.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAY-2007) Plant Protection Division, Institute of
            Vegetables and Flowers, Chinese Academy of Agricultural Sciences,
            No.12 Zhongguancun South St., Beijing 100081, P.R. China
FEATURES             Location/Qualifiers
     source          1..618
                     /organism="Radopholus similis"
                     /mol_type="mRNA"
                     /db_xref="taxon:46012"
     gene            1..618
                     /gene="flp-11"
                     /note="Rs-flp-11"
     CDS             68..454
                     /gene="flp-11"
                     /codon_start=1
                     /product="FMRFamide-like peptide 11"
                     /protein_id="ABU94332.1"
                     /db_xref="GI:156753305"
                     /translation="MAHHALSLFVAALPRPGTLLLLLVCAAAVFDCSAEAMTWKMRTD
                     KKAMRNALVRFGKRNAYRPAGEAFVGASGSEGGQNAYAGSLMRGVDGLVAFYNSAEQP
                     IWRLQRRALMDNSRGGVDEDAGRGVQ"
ORIGIN      
        1 tttaattacc caagtttgag agcaccacac tttctcccgg ttccatcgcc acattcagca
       61 attcagcatg gcccatcacg ccctctccct cttcgtagcg gctctcccac gcccgggcac
      121 tctgctcctg ctcctggtct gcgccgccgc cgtgttcgac tgcagtgcgg aggcgatgac
      181 gtggaagatg cgaacggaca agaaggcgat gcgaaatgcc ctggtccgat tcggcaagcg
      241 caacgcctat cgtcctgctg gcgaggcatt tgtgggcgca tctggctcgg agggtggcca
      301 gaacgcctat gcgggctcgc tgatgcgcgg tgtggacgga ctggtggcgt tttacaacag
      361 cgcggaacag ccgatttggc gtctgcagag acgagcactg atggacaaca gccgcggggg
      421 agtggacgag gacgcgggca gaggagtcca gtgagcgggc atcggccaga cggcagaagc
      481 aggagagtgt ttgtttgttg cttccacccg acgacaatcg ccagacagtc catttgtgtg
      541 tgagctgcgt gtgtttgtgt tccattttgc tgcataaaca acatgccaaa aaaaaaaaaa
      601 aaaaaaaaaa aaaaaaaa
//