LOCUS       AM691120                 460 bp    mRNA    linear   INV 26-MAR-2008
DEFINITION  Radopholus similis partial mRNA for transthyretin-like protein 4
            (ttl-4 gene).
ACCESSION   AM691120
VERSION     AM691120.1  GI:145279866
KEYWORDS    transthyretin-like protein 4; transthyretin-like protein 4
            precursor; ttl-4 gene.
SOURCE      Radopholus similis
  ORGANISM  Radopholus similis
            Eukaryota; Metazoa; Nematoda; Chromadorea; Tylenchida; Tylenchina;
            Tylenchoidea; Pratylenchidae; Radopholinae; Radopholus.
REFERENCE   1
  AUTHORS   Jacob,J., Vanholme,B., Haegeman,A. and Gheysen,G.
  TITLE     Four transthyretin-like genes of the migratory plant-parasitic
            nematode Radopholus similis: members of an extensive
            nematode-specific family
  JOURNAL   Gene 402 (1-2), 9-19 (2007)
   PUBMED   17765408
REFERENCE   2  (bases 1 to 460)
  AUTHORS   Jacob,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-APR-2007) Jacob J., Molecular Biotechnology, Ghent
            University, Coupure Links 653, 9000 Gent, BELGIUM
FEATURES             Location/Qualifiers
     source          1..460
                     /organism="Radopholus similis"
                     /mol_type="mRNA"
                     /db_xref="taxon:46012"
                     /country="Uganda"
     gene            <1..460
                     /gene="ttl-4"
     CDS             <1..460
                     /gene="ttl-4"
                     /codon_start=2
                     /product="transthyretin-like protein 4 precursor"
                     /protein_id="CAM84513.1"
                     /db_xref="GI:145279867"
                     /db_xref="InterPro:IPR001534"
                     /db_xref="UniProtKB/TrEMBL:A4Q9L4"
                     /translation="CFCSLGSAIRTQSAAVKGRLMCGAAPARNVRVKLFDEDSGPDPD
                     DQLDAGYTDSNGNFQLKGSTTEATNIDVVFKIYHDCDDGIKPGSRKIKFKIPNSYVSE
                     GATPKKTFDIGTLNLETIFANEERELIVSKKRRHLHHYRGGEKFNFFVRL"
     sig_peptide     <1..24
                     /gene="ttl-4"
     mat_peptide     25..457
                     /gene="ttl-4"
                     /product="transthyretin-like protein 4"
ORIGIN      
        1 gtgcttctgt tcccttggct cagcgatcag gactcagtct gctgctgtaa aaggtcgctt
       61 gatgtgtggt gcggcaccgg cgagaaatgt tcgagtcaaa ctgttcgatg aggattctgg
      121 acccgaccct gacgaccaat tagacgcagg ctacacggac tcaaatggga acttccagct
      181 gaagggctcc accaccgaag caaccaacat cgacgtcgtg ttcaagatct accacgactg
      241 cgacgatggg attaagcctg gctctcgcaa aatcaagttc aagattccca actcgtacgt
      301 cagtgaggga gccaccccca aaaaaacatt tgacatcggc acgctgaatc tggagaccat
      361 cttcgccaac gaggagaggg agttgatcgt gagcaagaaa aggcgacact tgcaccacta
      421 ccggggcggc gagaaattca actttttcgt tcgtctctag
//