LOCUS       AM691119                 423 bp    mRNA    linear   INV 26-MAR-2008
DEFINITION  Radopholus similis partial mRNA for transthyretin-like protein 3
            (ttl-3 gene).
ACCESSION   AM691119
VERSION     AM691119.1  GI:145279864
KEYWORDS    transthyretin-like protein 3; transthyretin-like protein 3
            precursor; ttl-3 gene.
SOURCE      Radopholus similis
  ORGANISM  Radopholus similis
            Eukaryota; Metazoa; Nematoda; Chromadorea; Tylenchida; Tylenchina;
            Tylenchoidea; Pratylenchidae; Radopholinae; Radopholus.
REFERENCE   1
  AUTHORS   Jacob,J., Vanholme,B., Haegeman,A. and Gheysen,G.
  TITLE     Four transthyretin-like genes of the migratory plant-parasitic
            nematode Radopholus similis: members of an extensive
            nematode-specific family
  JOURNAL   Gene 402 (1-2), 9-19 (2007)
   PUBMED   17765408
REFERENCE   2  (bases 1 to 423)
  AUTHORS   Jacob,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-APR-2007) Jacob J., Molecular Biotechnology, Ghent
            University, Coupure Links 653, 9000 Gent, BELGIUM
FEATURES             Location/Qualifiers
     source          1..423
                     /organism="Radopholus similis"
                     /mol_type="mRNA"
                     /db_xref="taxon:46012"
                     /country="Uganda"
     gene            <1..423
                     /gene="ttl-3"
     CDS             <1..423
                     /gene="ttl-3"
                     /codon_start=1
                     /product="transthyretin-like protein 3 precursor"
                     /protein_id="CAM84512.1"
                     /db_xref="GI:145279865"
                     /db_xref="InterPro:IPR001534"
                     /db_xref="UniProtKB/TrEMBL:A4Q9L3"
                     /translation="LFAVVLFAIITIVPSPCGAMRQQAVAVKGQLMCGSRPASGVKVK
                     LWDEDDGPDPDDVLDEAFTDSSGAFHLKGSERELTNIDPVLKIYHDCDDGIMPGQRKI
                     KLRIPGSYITGGGVAKRVFDVGLLNLETKFPGEERDLL"
     sig_peptide     <1..57
                     /gene="ttl-3"
     mat_peptide     58..420
                     /gene="ttl-3"
                     /product="transthyretin-like protein 3"
ORIGIN      
        1 ttgtttgcgg tggtgctctt cgccataatc accattgtgc cgtccccgtg cggagcaatg
       61 cgccaacagg cggtcgcagt caagggccag ctgatgtgcg ggtcgaggcc cgcctcgggg
      121 gtgaaggtga agctctggga cgaggacgac ggcccagacc cggacgacgt gctggacgag
      181 gcgttcaccg actccagcgg cgcattccac ctgaagggct ccgagcgcga gctgaccaac
      241 attgacccgg tgctcaaaat ctaccacgat tgcgacgacg ggattatgcc aggacagcgc
      301 aagatcaaac tgcgcattcc tggctcttac atcacgggcg gaggcgtcgc aaaacgcgtg
      361 ttcgacgttg gattgctcaa tttggagacc aaattcccgg gcgaggagcg agatttgctc
      421 tga
//