LOCUS       AM691117                 477 bp    mRNA    linear   INV 26-MAR-2008
DEFINITION  Radopholus similis mRNA for transthyretin-like protein 1 (ttl-1
            gene).
ACCESSION   AM691117
VERSION     AM691117.1  GI:145279860
KEYWORDS    transthyretin-like protein 1; transthyretin-like protein 1
            precursor; ttl-1 gene.
SOURCE      Radopholus similis
  ORGANISM  Radopholus similis
            Eukaryota; Metazoa; Nematoda; Chromadorea; Tylenchida; Tylenchina;
            Tylenchoidea; Pratylenchidae; Radopholinae; Radopholus.
REFERENCE   1
  AUTHORS   Jacob,J., Vanholme,B., Haegeman,A. and Gheysen,G.
  TITLE     Four transthyretin-like genes of the migratory plant-parasitic
            nematode Radopholus similis: members of an extensive
            nematode-specific family
  JOURNAL   Gene 402 (1-2), 9-19 (2007)
   PUBMED   17765408
REFERENCE   2  (bases 1 to 477)
  AUTHORS   Jacob,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-APR-2007) Jacob J., Molecular Biotechnology, Ghent
            University, Coupure Links 653, 9000 Gent, BELGIUM
FEATURES             Location/Qualifiers
     source          1..477
                     /organism="Radopholus similis"
                     /mol_type="mRNA"
                     /db_xref="taxon:46012"
                     /country="Uganda"
     gene            1..477
                     /gene="ttl-1"
     CDS             1..477
                     /gene="ttl-1"
                     /codon_start=1
                     /product="transthyretin-like protein 1 precursor"
                     /protein_id="CAM84510.1"
                     /db_xref="GI:145279861"
                     /db_xref="InterPro:IPR001534"
                     /db_xref="UniProtKB/TrEMBL:A4Q9L1"
                     /translation="MAPMFLPTVSVFLLLLVVVQQSLLVLASPKPLFGIGIGRTQSAG
                     VEGTLLCEGKPMADVLVKLYDDDRGVDTDDLMAEGKTDSKGRFSLEGYTHEFTTIDPK
                     INIYHDCNDLLPCQRKISIMIPDKYISSGKTPERYYNAGEVELEGKFKGEERDCLH"
     sig_peptide     1..81
                     /gene="ttl-1"
     mat_peptide     82..474
                     /gene="ttl-1"
                     /product="transthyretin-like protein 1"
ORIGIN      
        1 atggcgccta tgtttctgcc tacagtgtca gtcttcctgc tgctgctggt cgtcgtacaa
       61 cagtcattgc ttgtgttggc cagtccgaaa ccgttgtttg gcattggaat tgggcgcaca
      121 caaagtgccg gggtggaggg tacactgctt tgcgagggca aaccgatggc tgacgtgcta
      181 gtgaagctgt atgatgatga cagaggcgtt gataccgacg acctgatggc agaggggaag
      241 accgactcga agggacgctt ctcgcttgag ggatacaccc acgagttcac caccatcgac
      301 ccgaaaatta atatatacca cgactgcaac gacttgttgc catgccagcg caaaatctcg
      361 ataatgatcc cggacaagta tatttccagt ggaaaaacgc cggaacgata ctataatgcg
      421 ggcgaggttg agctggaggg caagttcaag ggagaggagc gtgactgtct tcattga
//