Showing results for Origin = chloroplast
| PiperID | SEQUENCE | Ion | Score | Hits | Mass | Modification | Protein Name | Origin | Accession |
|---|---|---|---|---|---|---|---|---|---|
| Piper3 | AAEDPEFETFYTK | 1566 | 65.07 | 24 | 1546.6832 | photosystem II protein D2 | chloroplast | gi|108773048 | |
| Piper6 | AAPSFIQLDTK | 414 | 51.64 | 24 | 1189.634 | ATP synthase CF1 beta subunit | chloroplast | gi|169142798 | |
| Piper12 | ADEISNIIR | 449 | 68.69 | 24 | 1029.5451 | ATP synthase CF1 beta subunit | chloroplast | gi|11466709 | |
| Piper13 | ADEISNILR | 449 | 68.69 | 24 | 1029.5451 | ATP synthase CF1 alpha subunit | chloroplast | gi|395001660 | |
| Piper18 | ADVPFR | 8179 | 16.02 | 3 | 703.3656 | photosystem II CP47 chlorophyll apoprotein | chloroplast | gi|115605047 | |
| Piper33 | AHGGVSVFGGVGER | 4138 | 68.87 | 10 | 1327.6635 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper39 | AINQVRQRVFQQALQGALGTLNSCLNK | 1000 | 16.71 | 2 | 3013.5966 | [N-term] Acetyl (N-term)|[15] Deamidated (NQ)|[22] Deamidated (NQ) | ATP synthase CF0 subunit I | chloroplast | gi|114329642 |
| Piper74 | AQLGEIFELDR | 3516 | 72.31 | 11 | 1289.6618 | photosystem II CP47 chlorophyll apoprotein | chloroplast | gi|115605047 | |
| Piper78 | ARNEGRDLAREGNEIIR | 412 | 26.16 | 1 | 2011.0382 | [N-term] Acetyl (N-term)|[3] Deamidated (NQ) | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit | chloroplast | gi|108773138 |
| Piper93 | AVAMSATDGLTR | 2811 | 71.69 | 12 | 1207.5857 | [4] Oxidation (M) | ATPase beta subunit | chloroplast | gi|161784199 |
| Piper111 | CESACPTNFLSVR | 4595 | 58.72 | 20 | 1540.667 | [1] Carbamidomethyl (C)|[5] Carbamidomethyl (C)|[8] Deamidated (NQ) | photosystem I subunit VII | chloroplast | gi|149390408 |
| Piper116 | DAEAILK | 3152 | 29.96 | 7 | 758.4176 | ATP synthase CF1 beta subunit | chloroplast | gi|11466709 | |
| Piper120 | DANEQDVLLFIDNIFR | 8893 | 76.34 | 4 | 1920.9621 | ATP synthase CF1 beta chain | chloroplast | gi|222084091 | |
| Piper130 | DGSITSIQAIYVPADDLTDPAPATTFAHLDATTVLSR | 421 | 60.62 | 22 | 3842.9259 | ATP synthase CF1 beta subunit | chloroplast | gi|806636950 | |
| Piper133 | DINEQDVLLFIDNIFR | 901 | 101.82 | 17 | 2006.0131 | [N-term] Acetyl (N-term)|[3] Deamidated (NQ) | ATP synthase CF1 beta subunit | chloroplast | gi|695101509 |
| Piper142 | DNFVEKDR | 2519 | 47.66 | 8 | 1022.4676 | [2] Deamidated (NQ) | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit | chloroplast | gi|156618912 |
| Piper154 | DVFAGIDPDLDSQVEFGTFQK | 6522 | 76.99 | 2 | 2327.0985 | photosystem II CP47 chlorophyll apoprotein | chloroplast | gi|115605047 | |
| Piper156 | DVNEQDVLLFIDNIFR | 491 | 108.44 | 22 | 1948.9916 | atpB gene product | chloroplast | gi|359422268 | |
| Piper161 | EAIQEQIELFLLQEQASTSPSYS | 31 | 17.29 | 1 | 2611.2234 | [6] Deamidated (NQ) | ATP synthase CF1 alpha subunit | chloroplast | gi|383931175 |
| Piper166 | EAYPGDVFYLHSR | 5357 | 57.64 | 24 | 1552.7332 | ATP synthase CF1 beta subunit | chloroplast | gi|11466709 | |
| Piper174 | EGNEIIRRAIR | 522 | 12.11 | 2 | 1308.7403 | [N-term] Glu->pyro-Glu (N-term E)|[3] Deamidated (NQ) | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit | chloroplast | gi|218176252 |
| Piper178 | EGPNLLK | 1347 | 28.97 | 15 | 769.4334 | ATP synthase CF1 alpha subunit | chloroplast | gi|108773075 | |
| Piper181 | EGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR | 421 | 100.12 | 22 | 3842.9259 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper186 | EIILPTNSGQIGVLPNHAPIATAVDIGILR | 4951 | 21.77 | 2 | 3093.6962 | [10] Deamidated (NQ)|[16] Deamidated (NQ) | ATP synthase CF1 epsilon subunit | chloroplast | gi|115605028 |
| Piper187 | EILVIGPVPGQK | 8222 | 38.24 | 8 | 1290.7659 | [N-term] Acetyl (N-term) | cytochrome f | chloroplast | gi|150251483 |
| Piper188 | EINVTCEVQQLLGNNR | 2448 | 55.08 | 22 | 1867.9214 | [N-term] Glu->pyro-Glu (N-term E)|[6] Carbamidomethyl (C) | ATP synthase CF1 beta subunit | chloroplast | gi|340034205 |
| Piper195 | EITLGFVDLLRDNFVEK | 1585 | 52.45 | 18 | 2008.0539 | [13] Deamidated (NQ) | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit | chloroplast | gi|156618912 |
| Piper196 | EITLGFVDLLRDNFVEKDR | 945 | 72.01 | 22 | 2279.1797 | [13] Deamidated (NQ) | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit | chloroplast | gi|156618912 |
| Piper207 | ELIIGDR | 946 | 32.64 | 15 | 814.4551 | ATP synthase CF1 beta subunit | chloroplast | gi|11466709 | |
| Piper210 | ELQDIIAILGLDELSEEDRLTVAR | 5842 | 35.77 | 4 | 2710.4422 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper214 | ENGLLLHIHR | 3594 | 40.54 | 12 | 1243.6786 | [N-term] Acetyl (N-term)|[2] Deamidated (NQ) | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit | chloroplast | gi|156618912 |
| Piper222 | EQVEVRNSADSMVYQTEK | 9022 | 9.99 | 2 | 2171.9521 | [N-term] Acetyl (N-term)|[2] Deamidated (NQ)|[12] Oxidation (M)|[15] Deamidated (NQ) | Heat Shock Protein 70 | chloroplast | gi|145342483 |
| Piper228 | ESGVINEQNIAESK | 252 | 77.17 | 24 | 1516.738 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper229 | ESGVINQENIAESK | 252 | 64.36 | 24 | 1516.738 | ATP synthase CF1 beta subunit | chloroplast | gi|519704511 | |
| Piper230 | ETDVLAAFR | 14970 | 25.43 | 2 | 1002.5127 | [N-term] Glu->pyro-Glu (N-term E) | large subunit of Rubisco | chloroplast | gi|649132073 |
| Piper233 | ETTENESANEGYR | 3765 | 59.12 | 24 | 1498.618 | photosystem II protein D1 | chloroplast | gi|108773110 | |
| Piper237 | EVKILNMGTVLQVGDGIAR | 1583 | 53.59 | 22 | 2011.0698 | [N-term] Glu->pyro-Glu (N-term E)|[6] Deamidated (NQ)|[7] Oxidation (M) | ATP synthase CF1 subunit alpha | chloroplast | gi|814072021 |
| Piper259 | FLVQLR | 1305 | 35.33 | 7 | 774.4753 | ATP synthase CF1 beta subunit | chloroplast | gi|11466709 | |
| Piper269 | FVFCAEAIYK | 409 | 39.14 | 30 | 1246.6055 | [4] Carbamidomethyl (C) | ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit | chloroplast | gi|772649789 |
| Piper271 | FVQAGSEISALLGR | 381 | 31.66 | 14 | 1489.7894 | [N-term] Acetyl (N-term)|[3] Deamidated (NQ) | ATP synthase CF1 beta subunit | chloroplast | gi|187763109 |
| Piper272 | FVQAGSEVSALLGR | 232 | 100.45 | 24 | 1432.7676 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper274 | FWDLR | 9887 | 33.98 | 10 | 735.3707 | photosystem II 44 kDa protein | chloroplast | gi|108773126 | |
| Piper279 | GAAIEQLEK | 2999 | 36.91 | 20 | 957.5163 | ATP synthase CF0 subunit I | chloroplast | gi|115605008 | |
| Piper309 | GIYPAVDPLDSTSTMLQPR | 6722 | 56.91 | 10 | 2076.0203 | [15] Oxidation (M) | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 |
| Piper323 | GMEVIDTGAPLSVPVGGTTLGR | 6789 | 8.57 | 2 | 2142.101 | [2] Oxidation (M) | ATP synthase CF1 beta subunit | chloroplast | gi|323149089 |
| Piper324 | GMEVIDTGTALSVPVGGATLGR | 6789 | 21.23 | 2 | 2142.101 | [N-term] Acetyl (N-term) | ATP synthase beta subunit | chloroplast | gi|119368506 |
| Piper325 | GMEVIDTGTPLSVPVGGATLGR | 6789 | 51.87 | 2 | 2142.101 | [2] Oxidation (M) | ATP synthase CF1 beta subunit | chloroplast | gi|139387437 |
| Piper326 | GMQVIDTGTPLSVPVGGATLGR | 6789 | 55.7 | 2 | 2142.101 | [2] Oxidation (M)|[3] Deamidated (NQ) | ATP synthase CF1 beta subunit | chloroplast | gi|393396089 |
| Piper365 | HTLIIYDDLSK | 2532 | 64.73 | 23 | 1316.6971 | ATP synthase CF1 alpha chain | chloroplast | gi|292559496 | |
| Piper374 | IAQIPVSEAYLGR | 560 | 78.9 | 24 | 1415.772 | ATP synthase CF1 beta subunit | chloroplast | gi|11466709 | |
| Piper375 | IAQIPVSESFLGR | 560 | 65.18 | 24 | 1415.772 | ATP synthase CF1 subunit alpha | chloroplast | gi|542687237 | |
| Piper384 | IFNVLGEPIDNLGPVDTR | 1474 | 22.57 | 16 | 2011.0377 | [N-term] Acetyl (N-term)|[3] Deamidated (NQ) | ATP synthase CF1 beta subunit | chloroplast | gi|752789793 |
| Piper385 | IFNVLGEPVDELGPVDTR | 412 | 24.28 | 6 | 2011.0382 | [N-term] Acetyl (N-term) | ATP synthase CF1 beta subunit | chloroplast | gi|115391911 |
| Piper386 | IFNVLGEPVDNLGPVDTR | 143 | 92.08 | 24 | 1954.0168 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper393 | IGLFGGAGVGK | 599 | 58.71 | 20 | 974.5545 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper394 | IGLFGGGAGVGK | 878 | 60.79 | 20 | 1031.5761 | ATP synthase CF1 beta subunit | chloroplast | gi|533310112 | |
| Piper396 | IGNNEITILVNDAER | 3241 | 83.56 | 12 | 1669.8637 | ATP synthase CF1 epsilon subunit | chloroplast | gi|115605028 | |
| Piper407 | IIQIIGPVLDVAFPPGK | 3980 | 48.75 | 16 | 1819.0603 | [N-term] Acetyl (N-term)|[3] Deamidated (NQ) | ATP synthase CF1 beta subunit | chloroplast | gi|442742970 |
| Piper439 | ITQIIGPVLDVVFPPGKMPYIYNALIVQGRDTVGKQINVTCEVQQLLGNNR | 800 | 16.46 | 2 | 5670.9176 | [N-term] Acetyl (N-term)|[3] Deamidated (NQ)|[23] Deamidated (NQ)|[28] Deamidated (NQ)|[36] Deamidat | ATP synthase CF1 beta subunit | chloroplast | gi|295136979 |
| Piper442 | IVGEEHYETAQR | 726 | 92.5 | 22 | 1430.6788 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper451 | IVQIIGPVLDVAFPPGK | 1996 | 56.69 | 24 | 1762.0391 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper452 | IVQIIGPVLDVAFQPGQMPNIYNALRVVASENIKDEVICEVQQLLGDHCVR | 2776 | 14.54 | 2 | 5744.9346 | [N-term] Acetyl (N-term)|[3] Deamidated (NQ)|[14] Deamidated (NQ)|[43] Deamidated (NQ)|[49] Carbamid | ATP synthase CF1 beta subunit | chloroplast | gi|806637011 |
| Piper453 | IVSNEHYETAQR | 2291 | 42.2 | 18 | 1487.6977 | [N-term] Acetyl (N-term) | ATP synthase CF1 subunit beta | chloroplast | gi|772650081 |
| Piper454 | IYDTCIGCTQCVR | 1897 | 69.7 | 22 | 1644.7066 | [5] Carbamidomethyl (C)|[8] Carbamidomethyl (C)|[11] Carbamidomethyl (C) | photosystem I subunit VII | chloroplast | gi|108773054 |
| Piper471 | KIMKNIRVYCLLLR | 1536 | 13.53 | 3 | 1835.0525 | [3] Oxidation (M)|[10] Carbamidomethyl (C) | hypothetical protein | chloroplast | gi|810932592 |
| Piper472 | KINPTTSVPGVSTLEK | 4884 | 21.18 | 3 | 1711.9246 | [N-term] Acetyl (N-term) | ATP synthase beta subunit | chloroplast | gi|119368506 |
| Piper479 | KNQLENALR | 1045 | 62.21 | 24 | 1086.5665 | [2] Deamidated (NQ)|[3] Deamidated (NQ) | hypothetical protein | chloroplast | gi|810932592 |
| Piper502 | LAFYDYIGNNPAK | 2603 | 77.8 | 24 | 1484.731 | photosystem II CP47 chlorophyll apoprotein | chloroplast | gi|115605047 | |
| Piper521 | LGANVGSAQGPTGLGK | 1630 | 67.21 | 12 | 1425.7538 | photosystem II 44 kDa protein | chloroplast | gi|108773126 | |
| Piper534 | LIESPAPGIISR | 326 | 49.17 | 24 | 1251.7186 | atpA gene product | chloroplast | gi|374249689 | |
| Piper578 | LSIFETGIK | 662 | 35.18 | 24 | 1006.5695 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper585 | LTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDR | 419 | 40.06 | 12 | 3910.9086 | [N-term] Acetyl (N-term)|[4] Deamidated (NQ) | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit | chloroplast | gi|788229343 |
| Piper612 | MSGGDHVHAGTVVGK | 5007 | 25.61 | 9 | 1466.6912 | [1] Oxidation (M) | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit | chloroplast | gi|630716250 |
| Piper613 | MTPQTGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDR | 1423 | 22.2 | 2 | 3906.7776 | [1] Oxidation (M)|[4] Deamidated (NQ) | large subunit of Rubisco | chloroplast | gi|649132073 |
| Piper635 | NGITMIRNHIVSAAAAVTTQEGTIAQIIGPVCDVTFKAGNMPNIYDAVLVETK | 567 | 22.57 | 2 | 5670.9176 | [N-term] Acetyl (N-term)|[32] Carbamidomethyl (C)|[41] Oxidation (M)|[43] Deamidated (NQ) | CF1 beta subunit of ATP synthase | chloroplast | gi|699008381 |
| Piper643 | NILVIGPVPGQK | 2848 | 49.25 | 23 | 1233.7446 | cytochrome f | chloroplast | gi|110227092 | |
| Piper644 | NKPQFQEIISSTK | 1153 | 37.86 | 24 | 1518.8037 | ATP synthase CF1 alpha chain | chloroplast | gi|292559496 | |
| Piper650 | NNGLLLHIHR | 1397 | 56.93 | 12 | 1186.6553 | [2] Deamidated (NQ) | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit | chloroplast | gi|161622318 |
| Piper673 | QGIPLITGR | 5284 | 26.44 | 14 | 936.5389 | [N-term] Gln->pyro-Glu (N-term Q) | photosystem II protein V | chloroplast | gi|108773147 |
| Piper676 | QGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR | 421 | 102.32 | 22 | 3842.9259 | [8] Deamidated (NQ) | ATP synthase CF1 beta chain | chloroplast | gi|511943463 |
| Piper679 | QINVTCEVQQLLGNNR | 787 | 91.54 | 36 | 1884.9558 | [6] Carbamidomethyl (C) | ATP synthase CF1 subunit beta | chloroplast | gi|814072022 |
| Piper714 | RAQLGEIFELDR | 9543 | 40.57 | 3 | 1445.7624 | photosystem II CP47 chlorophyll apoprotein | chloroplast | gi|115605047 | |
| Piper723 | RNGITMIRNHIVSAAAAVTTQEGTIAQIIGPVCDVTFKAGNMPNIYDAVLVETK | 228 | 18.1 | 2 | 5728.9317 | [2] Deamidated (NQ)|[6] Oxidation (M)|[44] Deamidated (NQ) | CF1 beta subunit of ATP synthase | chloroplast | gi|699008381 |
| Piper730 | RTVIGNLLKPLNSEYGK | 8298 | 29.87 | 6 | 1902.0586 | [6] Deamidated (NQ) | psbH gene product | chloroplast | gi|380448732 |
| Piper735 | SAPAFIQLDTK | 414 | 72.21 | 24 | 1189.634 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper736 | SAPAFVQLETK | 414 | 31.77 | 24 | 1189.634 | ATP synthase CF1 subunit beta | chloroplast | gi|772650081 | |
| Piper762 | SNLINAASENLER | 1150 | 62.26 | 24 | 1429.7181 | ATP synthase CF0 subunit I | chloroplast | gi|115605008 | |
| Piper763 | SNNTVYNATAAGTITK | 5316 | 68 | 6 | 1624.806 | cytochrome f | chloroplast | gi|115605035 | |
| Piper779 | SVYEPLQTGLVAVDAMIPIGRGQR | 2869 | 11.55 | 2 | 2586.3588 | [7] Deamidated (NQ)|[16] Oxidation (M) | ATP synthase CF1 alpha subunit | chloroplast | gi|108773075 |
| Piper791 | TAVATDTIINQK | 1002 | 64.13 | 24 | 1273.6879 | AtpA | chloroplast | gi|456061396 | |
| Piper830 | TVIGNLLKPLNSEYGK | 1083 | --- | --- | 1745.9581 | [11] Deamidated (NQ) | psbH gene product | chloroplast | gi|380448732 |
| Piper832 | TVLIMELINNIAK | 6133 | 55.34 | 12 | 1486.8435 | [5] Oxidation (M) | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 |
| Piper863 | VFQQALQGALGTLNSCLNK | 4253 | 38.39 | 10 | 2061.0672 | [16] Carbamidomethyl (C) | ATP synthase CF0 subunit I | chloroplast | gi|115605008 |
| Piper872 | VHTVVINDPGR | 11565 | 34.37 | 3 | 1205.6514 | photosystem II 47 kDa protein | chloroplast | gi|108773059 | |
| Piper875 | VINALAKPIDGR | 1970 | 40.97 | 24 | 1265.7456 | ATP synthase CF1 beta subunit | chloroplast | gi|11466709 | |
| Piper877 | VINTWADIINR | 909 | 68.66 | 24 | 1313.7092 | photosystem II protein D1 | chloroplast | gi|108773110 | |
| Piper878 | VIQIIGPVLDVAFPPGK | 1996 | 56.69 | 24 | 1762.0391 | ATP synthase CF1 beta subunit | chloroplast | gi|81301573 | |
| Piper889 | VLNALAKPIDGR | 1476 | 37.38 | 8 | 1265.7459 | ATP synthase CF1 alpha subunit | chloroplast | gi|342316106 | |
| Piper891 | VLNTWADIINR | 909 | 68.66 | 24 | 1313.7092 | photosystem II protein D1 | chloroplast | gi|108773067 | |
| Piper915 | VSLEACVQAR | 207 | 81.36 | 65 | 1131.5691 | [6] Carbamidomethyl (C) | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit | chloroplast | gi|630716250 |
| Piper927 | VVDLLAPYR | 866 | 45.95 | 24 | 1044.5961 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper928 | VVDLLAPYRR | 2529 | 40.5 | 20 | 1200.6978 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper954 | YKELQDIIAILGLDELSEEDRLTVAR | 2997 | 70.48 | 12 | 3001.5999 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 |