Showing results for Ion = 1539
| PiperID | SEQUENCE | Ion | Score | Hits | Mass | Modification | Protein Name | Origin | Accession |
|---|---|---|---|---|---|---|---|---|---|
| Piper609 | MIGVWGMGGVGKTTLANQVAKNAEEDKLFEK | 1539 | 21.27 | 2 | 3364.6383 | [N-term] Acetyl (N-term)|[17] Deamidated (NQ)|[22] Deamidated (NQ) | PREDICTED: probable disease resistance protein At4g27220 | gi|731416899 |