PiperID Sequence Ion Score Hits Mass Modification Protein Name Origin Accession

Showing results for Hits = 22

PiperIDSEQUENCEIonScoreHitsMassModificationProtein NameOriginAccession
Piper10 ADAFEYADQVLEK 1698 79.17 22 1497.6991 thylakoid lumen protein 18.3 Chloroplastic gi|18405061
Piper15 ADLNVPLDENQNITDDTR 2867 69 22 2041.9573 PREDICTED: phosphoglycerate kinase chloroplastic-like gi|743791533
Piper30 AGVPELAAAQELAR 2871 72.61 22 1394.7509 Plastid transcriptionally active 16 gi|590588965
Piper34 AIALTVDTPILGR 2125 72.45 22 1338.7864 peroxisomal glycolate oxidase gi|351726610
Piper37 AIGAELDLSDKPVGLGVR 2333 94.02 22 1809.0006 PREDICTED: peroxiredoxin-2E chloroplastic gi|731345378
Piper45 AKFEEISSDLLDR 3982 62.23 22 1521.7697 heat shock protein 70 gi|545368344
Piper60 ALSVSPGNTVLYSK 235 41.41 22 1434.772 PREDICTED: 20 kDa chaperonin chloroplastic gi|460412635
Piper68 APDFEAEAVFDQEFINVK 2769 86.68 22 2067.9806 PREDICTED: 2-Cys peroxiredoxin BAS1 chloroplastic gi|743817950
Piper126 DEGIDLLKDK 3643 32.86 22 1144.596 Heat shock protein gi|357445271
Piper130 DGSITSIQAIYVPADDLTDPAPATTFAHLDATTVLSR 421 60.62 22 3842.9259 ATP synthase CF1 beta subunit chloroplast gi|806636950
Piper138 DLINVLEDAIR 971 76.02 22 1269.6929 Chaperonin 60 subunit beta 2 gi|703124594
Piper156 DVNEQDVLLFIDNIFR 491 108.44 22 1948.9916 atpB gene product chloroplast gi|359422268
Piper171 EFAAEEISAQVLR 3167 61.23 22 1443.7364 [N-term] Glu->pyro-Glu (N-term E) heat shock protein 70 gi|545368344
Piper173 EGLLQLPSDK 2958 45.67 22 1098.5919 PREDICTED: L-ascorbate peroxidase 2, cytosolic isoform X1 gi|697132537
Piper181 EGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR 421 100.12 22 3842.9259 ATP synthase CF1 beta subunit chloroplast gi|114107053
Piper188 EINVTCEVQQLLGNNR 2448 55.08 22 1867.9214 [N-term] Glu->pyro-Glu (N-term E)|[6] Carbamidomethyl (C) ATP synthase CF1 beta subunit chloroplast gi|340034205
Piper192 EITLGFVDLLRDDFIDKDR 945 60.77 22 2279.1797 PREDICTED: LOW QUALITY PROTEIN: ribulose bisphosphate carboxylase large chain partial gi|659133948
Piper196 EITLGFVDLLRDNFVEKDR 945 72.01 22 2279.1797 [13] Deamidated (NQ) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit chloroplast gi|156618912
Piper202 ELDYLVGAVSNPKKPFAAIVGGSK 1299 68.72 22 2460.3017 [11] Deamidated (NQ) Phosphoglycerate kinase gi|357451631
Piper220 EQKSAKDLLNAR 1052 58.35 22 1371.7358 predicted protein partial gi|255083813
Piper226 ESAQDIINVK 3450 49 22 1097.5715 [N-term] Glu->pyro-Glu (N-term E) PREDICTED: oxygen-evolving enhancer protein 3-1 chloroplastic gi|727553557
Piper237 EVKILNMGTVLQVGDGIAR 1583 53.59 22 2011.0698 [N-term] Glu->pyro-Glu (N-term E)|[6] Deamidated (NQ)|[7] Oxidation (M) ATP synthase CF1 subunit alpha chloroplast gi|814072021
Piper244 FDVVYDTVGQGEK 3695 81.15 22 1455.6881 PREDICTED: 2-methylene-furan-3-one reductase gi|698531094
Piper246 FFETFAAPFTK 2394 60.3 22 1304.6459 photosystem I reaction center subunit H-2 gi|15218186
Piper247 FFQTFAAPFTK 2394 60.3 22 1304.6459 [3] Deamidated (NQ) PREDICTED: photosystem I reaction center subunit VI chloroplastic-like gi|357132590
Piper249 FGEAVWFK 1486 54.36 22 982.4909 PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like gi|658040834
Piper256 FLEGGSLPTTK 1203 72.5 22 1148.6052 PREDICTED: ATP synthase gamma chain 1 chloroplastic-like gi|743793116
Piper276 FYTITTGANER 1349 50.59 22 1271.6149 PREDICTED: psbP-like protein 1 chloroplastic gi|802600413
Piper277 FYTLTTGANER 1349 50.59 22 1271.6149 Os10g0461100 gi|115482366
Piper282 GASTGYDNAVALPAGGR 1186 42.34 22 1618.7742 [N-term] Acetyl (N-term)|[8] Deamidated (NQ) PREDICTED: oxygen-evolving enhancer protein 1 chloroplastic-like gi|356559442
Piper288 GGHELSLTTGNAGGR 2155 79.27 22 1425.6964 PREDICTED: superoxide dismutase [Cu-Zn], chloroplastic gi|672175294
Piper296 GGSTGYDNAVALPAGGRGDEEELLKENIK 761 56.33 22 2959.4539 O2 evolving complex 33kD family protein gi|224084209
Piper310 GKDITELIASGR 3316 60.31 22 1258.6875 PREDICTED: uncharacterized protein LOC103407829 gi|658019157
Piper321 GLVGMAKMSK 3916 42.09 22 1052.5403 [5] Oxidation (M)|[8] Oxidation (M) PREDICTED: nematode resistance protein-like HSPRO1 gi|727445811
Piper333 GNVQPEAVLQTVSK 1143 51.52 22 1468.7829 PREDICTED: copper transport protein ATX1-like isoform X1 gi|697131531
Piper378 IDFGVCNALK 756 52.19 22 1079.5309 [7] Deamidated (NQ) PREDICTED: threonine--tRNA ligase mitochondrial-like gi|764615048
Piper397 IGPLGLSPK 4018 49.16 22 880.5382 Ribosomal protein L12, component of cytosolic 80S ribosome and 60S large subunit gi|145344539
Piper416 INNSYQNIYK 5626 44.47 22 1255.6211 co-chaperone grpE family protein gi|224126029
Piper421 IPLQSSSVVDLLDK 2020 33.32 22 1554.8621 [N-term] Acetyl (N-term) PREDICTED: LOW QUALITY PROTEIN: protein TPX2 gi|657979269
Piper431 ISIIKDVGGIIKPGR 418 37.93 22 1606.9664 [N-term] Acetyl (N-term) PREDICTED: pleiotropic drug resistance protein 3-like isoform X1 gi|702266774
Piper441 IVDWLAKEFK 3277 37.18 22 1247.6914 predicted protein partial gi|168034003
Piper442 IVGEEHYETAQR 726 92.5 22 1430.6788 ATP synthase CF1 beta subunit chloroplast gi|114107053
Piper454 IYDTCIGCTQCVR 1897 69.7 22 1644.7066 [5] Carbamidomethyl (C)|[8] Carbamidomethyl (C)|[11] Carbamidomethyl (C) photosystem I subunit VII chloroplast gi|108773054
Piper467 KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR 421 75.92 22 3842.9259 [8] Deamidated (NQ) H+-transporting two-sector ATPase family protein gi|224099437
Piper473 KLCLEPTSFTVK 1553 54.43 22 1421.7588 [3] Carbamidomethyl (C) PREDICTED: oxygen-evolving enhancer protein 1 chloroplastic gi|720025074
Piper494 KYAPDSAPALAINATIEK 2158 55.27 22 1914.0111 [N-term] Acetyl (N-term) photosystem I reaction center subunit III gi|226532407
Piper499 LADLVGVTLGPK 1507 83.45 22 1181.7021 TCP-1/cpn60 chaperonin family protein gi|590619306
Piper506 LASIADLYVNDAFGTAHR 1510 74.35 22 1932.9681 PREDICTED: phosphoglycerate kinase chloroplastic gi|225464995
Piper508 LASLADIYVNDAFGTAHR 1510 74.35 22 1932.9681 PREDICTED: phosphoglycerate kinase chloroplastic gi|586778226
Piper509 LASVVGVTLGPK 1507 59.08 22 1181.7021 [N-term] Acetyl (N-term) RuBisCO large subunit-binding protein subunit beta chloroplastic gi|760441059
Piper542 LIVVVFPSFGER 2393 53.03 22 1361.7706 PREDICTED: cysteine synthase gi|645222482
Piper543 LIYSSAFSSR 2033 50.3 22 1129.576 PREDICTED: probable plastid-lipid-associated protein 6 chloroplastic gi|695064427
Piper545 LLAGVTIAHGGVLPNINPVLLPK 2463 60.17 22 2305.389 PREDICTED: histone H2A-like gi|514820138
Piper548 LLFEVAPLGFLIEK 1761 60.15 22 1587.9285 PREDICTED: sedoheptulose-1,7-bisphosphatase chloroplastic gi|720002409
Piper566 LQQELNAMLSRPLQPK 3512 37.43 22 1866.022 [6] Deamidated (NQ) PREDICTED: DEAD-box ATP-dependent RNA helicase 13-like isoform X1 gi|568882351
Piper572 LSAIGFGPR 3547 62.05 22 916.5132 PREDICTED: thylakoid lumenal 29 kDa protein chloroplastic gi|449436992
Piper576 LSFSDIDEVILVGGSTR 1085 80.18 22 1806.9381 PREDICTED: stromal 70 kDa heat shock-related protein chloroplastic gi|747089332
Piper590 LVAAIDGLPDPGGPTFK 1563 77.65 22 1666.8938 hypothetical protein PHAVU_007G182400g gi|593688251
Piper592 LVDAFPGQSIDFFGAIR 1321 74.87 22 1851.9535 hypothetical protein CHLNCDRAFT_141315 gi|552810706
Piper593 LVDAFPGQSIDFFGALR 1321 74.87 22 1851.9535 PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 1 chloroplastic-like isoform X1 gi|565343799
Piper601 LYSIASSALGDFGDSK 2306 99.54 22 1629.7899 PREDICTED: ferredoxin--NADP reductase, leaf isozyme chloroplastic gi|672129741
Piper633 NEGIDLLKDK 3643 32.86 22 1144.596 [1] Deamidated (NQ) PREDICTED: stromal 70 kDa heat shock-related protein chloroplastic-like gi|470142981
Piper641 NILFVISKPDVFK 3201 67.81 22 1518.8809 PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 1 gi|225470846
Piper654 NPFGQIPVLEDGDLTLFESR 1667 53.82 22 2246.125 PREDICTED: glutathione S-transferase F13-like gi|657963639
Piper666 QATAQVLASQK 2194 53.84 22 1143.6234 PREDICTED: membrane-associated protein VIPP1 chloroplastic gi|460409347
Piper676 QGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR 421 102.32 22 3842.9259 [8] Deamidated (NQ) ATP synthase CF1 beta chain chloroplast gi|511943463
Piper710 QYFFLSVLTR 1434 40.45 22 1314.6974 [N-term] Acetyl (N-term) photosystem II oxygen-evolving complex protein 2 precursor gi|224085421
Piper716 RDPLEYFCQDNPETDECR 2438 37.3 22 2342.9287 [8] Carbamidomethyl (C)|[17] Carbamidomethyl (C) conserved hypothetical protein gi|255539356
Piper853 VEAYWPGLFAK 3409 39.94 22 1279.6601 Os08g0116500 gi|115474515
Piper859 VEVEYYGSPVSLK 1388 73.97 22 1468.7499 PREDICTED: ribosome-recycling factor chloroplastic isoform X1 gi|743760069
Piper923 VVDALGVPIDGR 2865 52.34 22 1209.6717 PREDICTED: ATP synthase subunit alpha mitochondrial gi|743900113
Piper924 VVDLADIVANNWK 1219 67.87 22 1455.7721 PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A chloroplastic gi|747048872
Piper929 VVDLYQDK 1118 51.17 22 979.4967 [6] Deamidated (NQ) T24P13.6 gi|297851012
Piper936 VVNALGVPIDGR 2865 52.52 22 1209.6717 [3] Deamidated (NQ) hypothetical protein L484_020266 gi|703071242