Showing results for Hits = 22
| PiperID | SEQUENCE | Ion | Score | Hits | Mass | Modification | Protein Name | Origin | Accession |
|---|---|---|---|---|---|---|---|---|---|
| Piper10 | ADAFEYADQVLEK | 1698 | 79.17 | 22 | 1497.6991 | thylakoid lumen protein 18.3 | Chloroplastic | gi|18405061 | |
| Piper15 | ADLNVPLDENQNITDDTR | 2867 | 69 | 22 | 2041.9573 | PREDICTED: phosphoglycerate kinase | chloroplastic-like | gi|743791533 | |
| Piper30 | AGVPELAAAQELAR | 2871 | 72.61 | 22 | 1394.7509 | Plastid transcriptionally active 16 | gi|590588965 | ||
| Piper34 | AIALTVDTPILGR | 2125 | 72.45 | 22 | 1338.7864 | peroxisomal glycolate oxidase | gi|351726610 | ||
| Piper37 | AIGAELDLSDKPVGLGVR | 2333 | 94.02 | 22 | 1809.0006 | PREDICTED: peroxiredoxin-2E | chloroplastic | gi|731345378 | |
| Piper45 | AKFEEISSDLLDR | 3982 | 62.23 | 22 | 1521.7697 | heat shock protein 70 | gi|545368344 | ||
| Piper60 | ALSVSPGNTVLYSK | 235 | 41.41 | 22 | 1434.772 | PREDICTED: 20 kDa chaperonin | chloroplastic | gi|460412635 | |
| Piper68 | APDFEAEAVFDQEFINVK | 2769 | 86.68 | 22 | 2067.9806 | PREDICTED: 2-Cys peroxiredoxin BAS1 | chloroplastic | gi|743817950 | |
| Piper126 | DEGIDLLKDK | 3643 | 32.86 | 22 | 1144.596 | Heat shock protein | gi|357445271 | ||
| Piper130 | DGSITSIQAIYVPADDLTDPAPATTFAHLDATTVLSR | 421 | 60.62 | 22 | 3842.9259 | ATP synthase CF1 beta subunit | chloroplast | gi|806636950 | |
| Piper138 | DLINVLEDAIR | 971 | 76.02 | 22 | 1269.6929 | Chaperonin 60 subunit beta 2 | gi|703124594 | ||
| Piper156 | DVNEQDVLLFIDNIFR | 491 | 108.44 | 22 | 1948.9916 | atpB gene product | chloroplast | gi|359422268 | |
| Piper171 | EFAAEEISAQVLR | 3167 | 61.23 | 22 | 1443.7364 | [N-term] Glu->pyro-Glu (N-term E) | heat shock protein 70 | gi|545368344 | |
| Piper173 | EGLLQLPSDK | 2958 | 45.67 | 22 | 1098.5919 | PREDICTED: L-ascorbate peroxidase 2, cytosolic isoform X1 | gi|697132537 | ||
| Piper181 | EGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR | 421 | 100.12 | 22 | 3842.9259 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper188 | EINVTCEVQQLLGNNR | 2448 | 55.08 | 22 | 1867.9214 | [N-term] Glu->pyro-Glu (N-term E)|[6] Carbamidomethyl (C) | ATP synthase CF1 beta subunit | chloroplast | gi|340034205 |
| Piper192 | EITLGFVDLLRDDFIDKDR | 945 | 60.77 | 22 | 2279.1797 | PREDICTED: LOW QUALITY PROTEIN: ribulose bisphosphate carboxylase large chain | partial | gi|659133948 | |
| Piper196 | EITLGFVDLLRDNFVEKDR | 945 | 72.01 | 22 | 2279.1797 | [13] Deamidated (NQ) | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit | chloroplast | gi|156618912 |
| Piper202 | ELDYLVGAVSNPKKPFAAIVGGSK | 1299 | 68.72 | 22 | 2460.3017 | [11] Deamidated (NQ) | Phosphoglycerate kinase | gi|357451631 | |
| Piper220 | EQKSAKDLLNAR | 1052 | 58.35 | 22 | 1371.7358 | predicted protein | partial | gi|255083813 | |
| Piper226 | ESAQDIINVK | 3450 | 49 | 22 | 1097.5715 | [N-term] Glu->pyro-Glu (N-term E) | PREDICTED: oxygen-evolving enhancer protein 3-1 | chloroplastic | gi|727553557 |
| Piper237 | EVKILNMGTVLQVGDGIAR | 1583 | 53.59 | 22 | 2011.0698 | [N-term] Glu->pyro-Glu (N-term E)|[6] Deamidated (NQ)|[7] Oxidation (M) | ATP synthase CF1 subunit alpha | chloroplast | gi|814072021 |
| Piper244 | FDVVYDTVGQGEK | 3695 | 81.15 | 22 | 1455.6881 | PREDICTED: 2-methylene-furan-3-one reductase | gi|698531094 | ||
| Piper246 | FFETFAAPFTK | 2394 | 60.3 | 22 | 1304.6459 | photosystem I reaction center subunit H-2 | gi|15218186 | ||
| Piper247 | FFQTFAAPFTK | 2394 | 60.3 | 22 | 1304.6459 | [3] Deamidated (NQ) | PREDICTED: photosystem I reaction center subunit VI | chloroplastic-like | gi|357132590 |
| Piper249 | FGEAVWFK | 1486 | 54.36 | 22 | 982.4909 | PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like | gi|658040834 | ||
| Piper256 | FLEGGSLPTTK | 1203 | 72.5 | 22 | 1148.6052 | PREDICTED: ATP synthase gamma chain 1 | chloroplastic-like | gi|743793116 | |
| Piper276 | FYTITTGANER | 1349 | 50.59 | 22 | 1271.6149 | PREDICTED: psbP-like protein 1 | chloroplastic | gi|802600413 | |
| Piper277 | FYTLTTGANER | 1349 | 50.59 | 22 | 1271.6149 | Os10g0461100 | gi|115482366 | ||
| Piper282 | GASTGYDNAVALPAGGR | 1186 | 42.34 | 22 | 1618.7742 | [N-term] Acetyl (N-term)|[8] Deamidated (NQ) | PREDICTED: oxygen-evolving enhancer protein 1 | chloroplastic-like | gi|356559442 |
| Piper288 | GGHELSLTTGNAGGR | 2155 | 79.27 | 22 | 1425.6964 | PREDICTED: superoxide dismutase [Cu-Zn], | chloroplastic | gi|672175294 | |
| Piper296 | GGSTGYDNAVALPAGGRGDEEELLKENIK | 761 | 56.33 | 22 | 2959.4539 | O2 evolving complex 33kD family protein | gi|224084209 | ||
| Piper310 | GKDITELIASGR | 3316 | 60.31 | 22 | 1258.6875 | PREDICTED: uncharacterized protein LOC103407829 | gi|658019157 | ||
| Piper321 | GLVGMAKMSK | 3916 | 42.09 | 22 | 1052.5403 | [5] Oxidation (M)|[8] Oxidation (M) | PREDICTED: nematode resistance protein-like HSPRO1 | gi|727445811 | |
| Piper333 | GNVQPEAVLQTVSK | 1143 | 51.52 | 22 | 1468.7829 | PREDICTED: copper transport protein ATX1-like isoform X1 | gi|697131531 | ||
| Piper378 | IDFGVCNALK | 756 | 52.19 | 22 | 1079.5309 | [7] Deamidated (NQ) | PREDICTED: threonine--tRNA ligase | mitochondrial-like | gi|764615048 |
| Piper397 | IGPLGLSPK | 4018 | 49.16 | 22 | 880.5382 | Ribosomal protein L12, component of cytosolic 80S ribosome and 60S large subunit | gi|145344539 | ||
| Piper416 | INNSYQNIYK | 5626 | 44.47 | 22 | 1255.6211 | co-chaperone grpE family protein | gi|224126029 | ||
| Piper421 | IPLQSSSVVDLLDK | 2020 | 33.32 | 22 | 1554.8621 | [N-term] Acetyl (N-term) | PREDICTED: LOW QUALITY PROTEIN: protein TPX2 | gi|657979269 | |
| Piper431 | ISIIKDVGGIIKPGR | 418 | 37.93 | 22 | 1606.9664 | [N-term] Acetyl (N-term) | PREDICTED: pleiotropic drug resistance protein 3-like isoform X1 | gi|702266774 | |
| Piper441 | IVDWLAKEFK | 3277 | 37.18 | 22 | 1247.6914 | predicted protein | partial | gi|168034003 | |
| Piper442 | IVGEEHYETAQR | 726 | 92.5 | 22 | 1430.6788 | ATP synthase CF1 beta subunit | chloroplast | gi|114107053 | |
| Piper454 | IYDTCIGCTQCVR | 1897 | 69.7 | 22 | 1644.7066 | [5] Carbamidomethyl (C)|[8] Carbamidomethyl (C)|[11] Carbamidomethyl (C) | photosystem I subunit VII | chloroplast | gi|108773054 |
| Piper467 | KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR | 421 | 75.92 | 22 | 3842.9259 | [8] Deamidated (NQ) | H+-transporting two-sector ATPase family protein | gi|224099437 | |
| Piper473 | KLCLEPTSFTVK | 1553 | 54.43 | 22 | 1421.7588 | [3] Carbamidomethyl (C) | PREDICTED: oxygen-evolving enhancer protein 1 | chloroplastic | gi|720025074 |
| Piper494 | KYAPDSAPALAINATIEK | 2158 | 55.27 | 22 | 1914.0111 | [N-term] Acetyl (N-term) | photosystem I reaction center subunit III | gi|226532407 | |
| Piper499 | LADLVGVTLGPK | 1507 | 83.45 | 22 | 1181.7021 | TCP-1/cpn60 chaperonin family protein | gi|590619306 | ||
| Piper506 | LASIADLYVNDAFGTAHR | 1510 | 74.35 | 22 | 1932.9681 | PREDICTED: phosphoglycerate kinase | chloroplastic | gi|225464995 | |
| Piper508 | LASLADIYVNDAFGTAHR | 1510 | 74.35 | 22 | 1932.9681 | PREDICTED: phosphoglycerate kinase | chloroplastic | gi|586778226 | |
| Piper509 | LASVVGVTLGPK | 1507 | 59.08 | 22 | 1181.7021 | [N-term] Acetyl (N-term) | RuBisCO large subunit-binding protein subunit beta | chloroplastic | gi|760441059 |
| Piper542 | LIVVVFPSFGER | 2393 | 53.03 | 22 | 1361.7706 | PREDICTED: cysteine synthase | gi|645222482 | ||
| Piper543 | LIYSSAFSSR | 2033 | 50.3 | 22 | 1129.576 | PREDICTED: probable plastid-lipid-associated protein 6 | chloroplastic | gi|695064427 | |
| Piper545 | LLAGVTIAHGGVLPNINPVLLPK | 2463 | 60.17 | 22 | 2305.389 | PREDICTED: histone H2A-like | gi|514820138 | ||
| Piper548 | LLFEVAPLGFLIEK | 1761 | 60.15 | 22 | 1587.9285 | PREDICTED: sedoheptulose-1,7-bisphosphatase | chloroplastic | gi|720002409 | |
| Piper566 | LQQELNAMLSRPLQPK | 3512 | 37.43 | 22 | 1866.022 | [6] Deamidated (NQ) | PREDICTED: DEAD-box ATP-dependent RNA helicase 13-like isoform X1 | gi|568882351 | |
| Piper572 | LSAIGFGPR | 3547 | 62.05 | 22 | 916.5132 | PREDICTED: thylakoid lumenal 29 kDa protein | chloroplastic | gi|449436992 | |
| Piper576 | LSFSDIDEVILVGGSTR | 1085 | 80.18 | 22 | 1806.9381 | PREDICTED: stromal 70 kDa heat shock-related protein | chloroplastic | gi|747089332 | |
| Piper590 | LVAAIDGLPDPGGPTFK | 1563 | 77.65 | 22 | 1666.8938 | hypothetical protein PHAVU_007G182400g | gi|593688251 | ||
| Piper592 | LVDAFPGQSIDFFGAIR | 1321 | 74.87 | 22 | 1851.9535 | hypothetical protein CHLNCDRAFT_141315 | gi|552810706 | ||
| Piper593 | LVDAFPGQSIDFFGALR | 1321 | 74.87 | 22 | 1851.9535 | PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 1 | chloroplastic-like isoform X1 | gi|565343799 | |
| Piper601 | LYSIASSALGDFGDSK | 2306 | 99.54 | 22 | 1629.7899 | PREDICTED: ferredoxin--NADP reductase, leaf isozyme | chloroplastic | gi|672129741 | |
| Piper633 | NEGIDLLKDK | 3643 | 32.86 | 22 | 1144.596 | [1] Deamidated (NQ) | PREDICTED: stromal 70 kDa heat shock-related protein | chloroplastic-like | gi|470142981 |
| Piper641 | NILFVISKPDVFK | 3201 | 67.81 | 22 | 1518.8809 | PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 1 | gi|225470846 | ||
| Piper654 | NPFGQIPVLEDGDLTLFESR | 1667 | 53.82 | 22 | 2246.125 | PREDICTED: glutathione S-transferase F13-like | gi|657963639 | ||
| Piper666 | QATAQVLASQK | 2194 | 53.84 | 22 | 1143.6234 | PREDICTED: membrane-associated protein VIPP1 | chloroplastic | gi|460409347 | |
| Piper676 | QGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSR | 421 | 102.32 | 22 | 3842.9259 | [8] Deamidated (NQ) | ATP synthase CF1 beta chain | chloroplast | gi|511943463 |
| Piper710 | QYFFLSVLTR | 1434 | 40.45 | 22 | 1314.6974 | [N-term] Acetyl (N-term) | photosystem II oxygen-evolving complex protein 2 precursor | gi|224085421 | |
| Piper716 | RDPLEYFCQDNPETDECR | 2438 | 37.3 | 22 | 2342.9287 | [8] Carbamidomethyl (C)|[17] Carbamidomethyl (C) | conserved hypothetical protein | gi|255539356 | |
| Piper853 | VEAYWPGLFAK | 3409 | 39.94 | 22 | 1279.6601 | Os08g0116500 | gi|115474515 | ||
| Piper859 | VEVEYYGSPVSLK | 1388 | 73.97 | 22 | 1468.7499 | PREDICTED: ribosome-recycling factor | chloroplastic isoform X1 | gi|743760069 | |
| Piper923 | VVDALGVPIDGR | 2865 | 52.34 | 22 | 1209.6717 | PREDICTED: ATP synthase subunit alpha | mitochondrial | gi|743900113 | |
| Piper924 | VVDLADIVANNWK | 1219 | 67.87 | 22 | 1455.7721 | PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A | chloroplastic | gi|747048872 | |
| Piper929 | VVDLYQDK | 1118 | 51.17 | 22 | 979.4967 | [6] Deamidated (NQ) | T24P13.6 | gi|297851012 | |
| Piper936 | VVNALGVPIDGR | 2865 | 52.52 | 22 | 1209.6717 | [3] Deamidated (NQ) | hypothetical protein L484_020266 | gi|703071242 |