Showing results for Hits = 2
| PiperID | SEQUENCE | Ion | Score | Hits | Mass | Modification | Protein Name | Origin | Accession |
|---|---|---|---|---|---|---|---|---|---|
| Piper2 | AADELRKEGKTVR | 7382 | 11.59 | 2 | 1513.8205 | [N-term] Acetyl (N-term) | Os06g0133800 | partial | gi|115466224 |
| Piper22 | AFVVHELQDDLGKGGHELSLTTGNAGGR | 4339 | 43.88 | 2 | 2878.4214 | [8] Deamidated (NQ) | PREDICTED: superoxide dismutase [Cu-Zn], | chloroplastic | gi|672175294 |
| Piper25 | AGGAVPYSDMTPLQAAVGVVQKGLRPGIPLNCPLPLAELMEACWAGNPVQRPSFR | 2776 | 31.06 | 2 | 5744.9346 | [14] Deamidated (NQ)|[21] Deamidated (NQ)|[31] Deamidated (NQ) | hypothetical protein VOLCADRAFT_64912 | gi|302845911 | |
| Piper26 | AGGYSSDGTQSVLDK | 5462 | 56.89 | 2 | 1483.6767 | PREDICTED: sedoheptulose-1,7-bisphosphatase | chloroplastic | gi|720002409 | |
| Piper29 | AGPAAAAR | 374 | 11.55 | 2 | 683.3645 | hypothetical protein PHAVU_008G011300g | partia | gi|593331584 | |
| Piper35 | AIFVDLEPTVIDEVR | 7383 | 35.07 | 2 | 1714.9101 | Os07g0574800 | gi|115472953 | ||
| Piper36 | AIGAAGSGGGGAASSGGSGSGSGSHHHQDASR | 3024 | 31.87 | 2 | 2733.1886 | [N-term] Acetyl (N-term) | Os07g0606600 | gi|115473263 | |
| Piper39 | AINQVRQRVFQQALQGALGTLNSCLNK | 1000 | 16.71 | 2 | 3013.5966 | [N-term] Acetyl (N-term)|[15] Deamidated (NQ)|[22] Deamidated (NQ) | ATP synthase CF0 subunit I | chloroplast | gi|114329642 |
| Piper40 | AIQQAVVSMKR | 5645 | 18.63 | 2 | 1289.6714 | [N-term] Acetyl (N-term)|[3] Deamidated (NQ)|[4] Deamidated (NQ)|[9] Oxidation (M) | PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103444373 | gi|657979140 | |
| Piper41 | AIRVNVAEERPR | 1324 | 13.6 | 2 | 1408.8041 | PREDICTED: 28 kDa ribonucleoprotein | chloroplastic-like | gi|225452270 | |
| Piper43 | AITVRRGK | 5764 | 18.75 | 2 | 941.5766 | [N-term] Acetyl (N-term) | PREDICTED: uncharacterized protein LOC103439527 | gi|657969188 | |
| Piper47 | ALALGASGIFIGR | 3852 | 61.01 | 2 | 1244.7229 | PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like | gi|747071890 | ||
| Piper48 | ALDSQIAALSQDIVK | 2904 | 33.48 | 2 | 1571.8498 | [11] Deamidated (NQ) | PREDICTED: ATP synthase subunit b' | chloroplastic | gi|769797378 |
| Piper55 | ALLVRAAQQTADRR | 2129 | 35.05 | 2 | 1568.8919 | [9] Deamidated (NQ) | hypothetical protein SORBIDRAFT_02g004390 | gi|242047582 | |
| Piper67 | ANVKEISFDQSSR | 7770 | 8.09 | 2 | 1522.7141 | [N-term] Acetyl (N-term)|[10] Deamidated (NQ) | PREDICTED: ruBisCO large subunit-binding protein subunit alpha | chloroplastic | gi|685300202 |
| Piper76 | AQVTTETPAK | 7578 | 15.07 | 2 | 1044.5333 | PREDICTED: ferredoxin--NADP reductase, leaf isozyme | chloroplastic | gi|672129741 | |
| Piper77 | ARLVVVQQQQQR | 4206 | 15.18 | 2 | 1451.835 | PREDICTED: chloroplast stem-loop binding protein of 41 kDa b | chloroplastic isoform X4 | gi|645221761 | |
| Piper79 | ARSAISSQKSLSGNFK | 4630 | 11.5 | 2 | 1722.91 | [N-term] Acetyl (N-term)|[14] Deamidated (NQ) | Ribulose bisphosphate carboxylase/oxygenase activase | gi|357469233 | |
| Piper82 | ASANAISTASILRSASPR | 6752 | 23.99 | 2 | 1813.9683 | [N-term] Acetyl (N-term) | PREDICTED: ruBisCO large subunit-binding protein subunit alpha | gi|695074715 | |
| Piper85 | ASLTQSAVFGKK | 4620 | 13.9 | 2 | 1278.6822 | [N-term] Acetyl (N-term)|[5] Deamidated (NQ) | psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving enhancer 1 | gi|145356482 | |
| Piper97 | AVITVPAYFNDSQR | 1988 | 36.03 | 2 | 1579.7982 | PREDICTED: heat shock 70 kDa protein 6 | chloroplastic | gi|685259957 | |
| Piper98 | AVQLSPSTPELFGK | 1032 | 11.8 | 2 | 1514.8137 | [N-term] Acetyl (N-term) | PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like | gi|702344661 | |
| Piper101 | AVVQVFEGTSGIDNK | 6169 | 81.56 | 2 | 1562.7984 | hypothetical protein CICLE_v10028070mg | gi|567859772 | ||
| Piper109 | CARCWVRGSMR | 5593 | 17.66 | 2 | 1323.6162 | PREDICTED: aspartate aminotransferase | cytoplasmic-like | gi|702301738 | |
| Piper110 | CCSGNSNNIRENKQRGTFSSLK | 5022 | 20.74 | 2 | 2603.094 | [N-term] Acetyl (N-term)|[1] Carbamidomethyl (C)|[2] Carbamidomethyl (C)|[5] Deamidated (NQ)|[7] Dea | hypothetical protein CARUB_v10013720mg | gi|565480100 | |
| Piper112 | CGGGGGNCGSQCGGENMANSGACGGCGGGCGGKNIANSGACGGCGGGCGSGCGGGGGGNCGGGCGGGCR | 447 | 17.51 | 2 | 5842.9826 | [N-term] Acetyl (N-term)|[16] Deamidated (NQ)|[19] Deamidated (NQ)|[30] Carbamidomethyl (C)|[34] Dea | PREDICTED: uncharacterized protein LOC103426317 | gi|658053745 | |
| Piper113 | CGQARGDVEQLLR | 3167 | 53.56 | 2 | 1443.7364 | uncharacterized protein LOC100277671 | gi|226533298 | ||
| Piper127 | DGFEQKLLQKVIIEVLPEWSTK | 6002 | 12.55 | 2 | 2642.4415 | [N-term] Acetyl (N-term)|[5] Deamidated (NQ) | diaminohydroxyphosphoribosylaminopyrimidine deaminase | gi|18415600 | |
| Piper129 | DGQLGHGYNEPGCSRPR | 7303 | 40.4 | 2 | 1884.7951 | [N-term] Acetyl (N-term)|[3] Deamidated (NQ) | hypothetical protein COCSUDRAFT_83510 | partial | gi|545362013 |
| Piper132 | DIELVMTQAGVSRSK | 8333 | 20.51 | 2 | 1633.8401 | [8] Deamidated (NQ) | PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 1 | gi|225470846 | |
| Piper134 | DIYSALNAVSGHYISFGPTAPIPSK | 5443 | 50.54 | 2 | 2604.3252 | PREDICTED: photosystem II repair protein PSB27-H1 | chloroplastic | gi|729448076 | |
| Piper136 | DIYSALNAVSGHYISFGPTSPIPAK | 5443 | 50.83 | 2 | 2604.3252 | PREDICTED: photosystem II repair protein PSB27-H1 | chloroplastic | gi|802754235 | |
| Piper141 | DMRQTVAVGVIK | 4006 | 21.33 | 2 | 1331.7233 | [2] Oxidation (M) | elongation factor alpha3 | gi|162460570 | |
| Piper145 | DNPLGVKAMKR | 1248 | 14.76 | 2 | 1243.6784 | [9] Oxidation (M) | PREDICTED: low-temperature-induced cysteine proteinase | gi|747056289 | |
| Piper146 | DSDNNLTEEDKRKLEK | 4898 | 30.5 | 2 | 1974.9648 | [N-term] Acetyl (N-term) | Translocon at the outer envelope membrane of chloroplasts 159 | gi|590567110 | |
| Piper154 | DVFAGIDPDLDSQVEFGTFQK | 6522 | 76.99 | 2 | 2327.0985 | photosystem II CP47 chlorophyll apoprotein | chloroplast | gi|115605047 | |
| Piper158 | EACSYCVEMIEMDFMMQPDTFAKLMK | 242 | 30.94 | 2 | 3164.2757 | [N-term] Acetyl (N-term)|[15] Oxidation (M)|[16] Oxidation (M) | PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820 | gi|685321387 | |
| Piper167 | ECHPEESVSADTTTVDVEK | 2144 | 17.33 | 2 | 2116.9115 | [N-term] Acetyl (N-term) | PREDICTED: zinc finger CCCH domain-containing protein 48-like | gi|731352925 | |
| Piper168 | EDDIVGILETDDIKDLKPLNDR | 5825 | 25.71 | 2 | 2525.2889 | 20 kDa chaperonin family protein | gi|224141565 | ||
| Piper174 | EGNEIIRRAIR | 522 | 12.11 | 2 | 1308.7403 | [N-term] Glu->pyro-Glu (N-term E)|[3] Deamidated (NQ) | ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit | chloroplast | gi|218176252 |
| Piper176 | EGNFDLVGINFPVFFIR | 2708 | 55.91 | 2 | 1983.9865 | [3] Deamidated (NQ) | PREDICTED: catalase isozyme 2-like isoform X1 | gi|702368491 | |
| Piper179 | EGPPTFNQPK | 5799 | 8.27 | 2 | 1114.5276 | [8] Deamidated (NQ) | hypothetical protein PRUPE_ppa005184mg | gi|595823869 | |
| Piper186 | EIILPTNSGQIGVLPNHAPIATAVDIGILR | 4951 | 21.77 | 2 | 3093.6962 | [10] Deamidated (NQ)|[16] Deamidated (NQ) | ATP synthase CF1 epsilon subunit | chloroplast | gi|115605028 |
| Piper194 | EITLGFVDLLRDDFVEKDR | 1577 | 16.45 | 2 | 2279.179 | ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit | plastid | gi|752789999 | |
| Piper197 | EKIGSGLVIASMVLQLQASCSK | 1623 | 47.23 | 2 | 2376.2639 | [N-term] Acetyl (N-term)|[12] Oxidation (M)|[20] Carbamidomethyl (C) | PREDICTED: uncharacterized protein LOC103842403 | gi|685366435 | |
| Piper198 | EKLQFNPQQVK | 7831 | 23.01 | 2 | 1358.7267 | [9] Deamidated (NQ) | PREDICTED: probable WRKY transcription factor 74 [Malus | gi|658020681 | |
| Piper201 | ELCKSINPDEAVAYGAAVQAALLSK | 1749 | 16.8 | 2 | 2661.3408 | [N-term] Acetyl (N-term)|[3] Carbamidomethyl (C)|[7] Deamidated (NQ)|[19] Deamidated (NQ) | Heat shock protein | gi|357448685 | |
| Piper203 | ELEENCKNMTDQLNEPILK | 368 | 21.16 | 2 | 2260.0336 | [N-term] Glu->pyro-Glu (N-term E)|[5] Deamidated (NQ)|[8] Deamidated (NQ)|[9] Oxidation (M) | PREDICTED: polynucleotide 3'-phosphatase ZDP-like | gi|573913994 | |
| Piper205 | ELGLTVENVIATAK | 3400 | 47.57 | 2 | 1456.8088 | Os04g0266900 | gi|115457470 | ||
| Piper212 | ELVAEGKPEKFGGSFLVPSYR | 650 | 19.31 | 2 | 2309.1842 | predicted protein | gi|168021458 | ||
| Piper217 | EPKFLKNGDAGYVK | 3021 | 17.04 | 2 | 1606.8216 | [N-term] Acetyl (N-term) | PREDICTED: elongation factor 1-alpha isoform 2 | gi|356558809 | |
| Piper218 | EQCLALGTRLRSKYK | 12993 | 5.28 | 2 | 1803.9896 | [N-term] Glu->pyro-Glu (N-term E)|[3] Carbamidomethyl (C) | photosystem I reaction center subunit D-2 | gi|15218708 | |
| Piper221 | EQSGESSAVDSSLLTK | 4136 | 20.36 | 2 | 1678.7843 | [N-term] Acetyl (N-term) | hypothetical protein POPTR_0002s02860g | gi|566155930 | |
| Piper222 | EQVEVRNSADSMVYQTEK | 9022 | 9.99 | 2 | 2171.9521 | [N-term] Acetyl (N-term)|[2] Deamidated (NQ)|[12] Oxidation (M)|[15] Deamidated (NQ) | Heat Shock Protein 70 | chloroplast | gi|145342483 |
| Piper230 | ETDVLAAFR | 14970 | 25.43 | 2 | 1002.5127 | [N-term] Glu->pyro-Glu (N-term E) | large subunit of Rubisco | chloroplast | gi|649132073 |
| Piper232 | ETGYLQDLVYK | 67 | 22.78 | 2 | 1328.6612 | [6] Deamidated (NQ) | Thylakoid lumenal 16.5 kDa protein | gi|357478143 | |
| Piper234 | ETTTIVGDGSTQEAVNKR | 2946 | 29.45 | 2 | 1904.9438 | TCP-1/cpn60 chaperonin family protein | gi|590619306 | ||
| Piper239 | EYKPDLNIVSNASCTTNCLAPLAK | 283 | 21.27 | 2 | 2664.2484 | [N-term] Acetyl (N-term)|[14] Carbamidomethyl (C)|[17] Deamidated (NQ) | glyceraldehyde 3-phosphate dehydrogenase family protein | gi|224055669 | |
| Piper241 | FDHVVVAIEESR | 7232 | 31.69 | 2 | 1441.71 | [N-term] Acetyl (N-term) | PREDICTED: uncharacterized protein LOC102666468 | gi|571561753 | |
| Piper242 | FDIDANGILSVTAVDK | 6823 | 51.17 | 2 | 1677.8545 | [6] Deamidated (NQ) | Chloroplast heat shock protein 70 isoform 1 | gi|590654488 | |
| Piper250 | FGLETSPINTK | 1738 | 34.07 | 2 | 1205.6303 | hypothetical protein POPTR_0003s02470g | gi|566160475 | ||
| Piper252 | FIVINMQVGIIMYLPTSDAR | 11758 | 38.75 | 2 | 2339.1931 | [N-term] Acetyl (N-term)|[5] Deamidated (NQ)|[12] Oxidation (M) | Os12g0139600 | gi|297612641 | |
| Piper260 | FNKVNYAGVSTNNYALDEILEVK | 10621 | 14.34 | 2 | 2602.2556 | [2] Deamidated (NQ)|[13] Deamidated (NQ) | photosystem I reaction center subunit IV A | gi|226503797 | |
| Piper261 | FNNKASKSR | 7981 | 17.72 | 2 | 1050.5471 | PREDICTED: ruBisCO large subunit-binding protein subunit alpha | chloroplastic-like | gi|460391345 | |
| Piper266 | FVAQGAYDSR | 4094 | 15.13 | 2 | 1112.5249 | hypothetical protein CICLE_v10028070mg | gi|567859772 | ||
| Piper286 | GGERLVGQIAK | 2730 | 14.36 | 2 | 1127.6187 | [8] Deamidated (NQ) | Os12g0244100 | gi|115487998 | |
| Piper287 | GGGKGARGVVSMAKK | 617 | 9.58 | 2 | 1401.7978 | PREDICTED: phosphoglycerate kinase | chloroplastic-like | gi|356525742 | |
| Piper289 | GGKGARGVVSMAKK | 336 | 10.46 | 2 | 1344.7766 | PREDICTED: phosphoglycerate kinase | chloroplastic | gi|356557028 | |
| Piper291 | GGSSSSGGGCCSGSSMTLDCSGVR | 5871 | 24.04 | 2 | 2252.8618 | [N-term] Acetyl (N-term)|[16] Oxidation (M)|[20] Carbamidomethyl (C) | RegA-like protein RlsG | gi|302842281 | |
| Piper300 | GGVVSGAADQRRK | 6373 | 16.01 | 2 | 1300.7001 | [10] Deamidated (NQ) | PREDICTED: disease resistance protein At4g27190-like | gi|702487157 | |
| Piper304 | GILAADESTGTIGKR | 7233 | 19.77 | 2 | 1487.7946 | Os08g0120600 | gi|115474567 | ||
| Piper306 | GINMAVDTVVTNLK | 1610 | 15.19 | 2 | 1490.7735 | [3] Deamidated (NQ)|[4] Oxidation (M) | PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform 1 | gi|356535474 | |
| Piper311 | GKGGKGMGK | 2279 | 20.06 | 2 | 876.4494 | [N-term] Acetyl (N-term)|[7] Oxidation (M) | PREDICTED: LOW QUALITY PROTEIN: histone H4-like | gi|658048037 | |
| Piper312 | GLCGGFNNNIIKKAEARIAELK | 2612 | 14.16 | 2 | 2400.2809 | [N-term] Acetyl (N-term) | PREDICTED: ATP synthase gamma chain | chloroplastic | gi|702351843 |
| Piper313 | GLDTSVNGPGVK | 12957 | 11.69 | 2 | 1143.5883 | [7] Deamidated (NQ) | Beta-fructofuranosidase, soluble isoenzyme I precursor | putative | gi|255539759 |
| Piper322 | GLVPLAGSNDESWCQGLDGLASR | 5495 | 35.93 | 2 | 2401.1362 | [14] Carbamidomethyl (C) | PREDICTED: fructose-bisphosphate aldolase 1 | chloroplastic | gi|747082340 |
| Piper323 | GMEVIDTGAPLSVPVGGTTLGR | 6789 | 8.57 | 2 | 2142.101 | [2] Oxidation (M) | ATP synthase CF1 beta subunit | chloroplast | gi|323149089 |
| Piper324 | GMEVIDTGTALSVPVGGATLGR | 6789 | 21.23 | 2 | 2142.101 | [N-term] Acetyl (N-term) | ATP synthase beta subunit | chloroplast | gi|119368506 |
| Piper325 | GMEVIDTGTPLSVPVGGATLGR | 6789 | 51.87 | 2 | 2142.101 | [2] Oxidation (M) | ATP synthase CF1 beta subunit | chloroplast | gi|139387437 |
| Piper326 | GMQVIDTGTPLSVPVGGATLGR | 6789 | 55.7 | 2 | 2142.101 | [2] Oxidation (M)|[3] Deamidated (NQ) | ATP synthase CF1 beta subunit | chloroplast | gi|393396089 |
| Piper327 | GMVDSLFQAPTGTGTHHAVLQSYEYVSQGLR | 2218 | 22.12 | 2 | 3392.5828 | [N-term] Acetyl (N-term)|[8] Deamidated (NQ)|[21] Deamidated (NQ) | PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 1 | chloroplastic isoform X1 | gi|697180392 |
| Piper328 | GNDPEDMQK | 13278 | 21.89 | 2 | 1092.3941 | [N-term] Acetyl (N-term)|[2] Deamidated (NQ)|[7] Oxidation (M)|[8] Deamidated (NQ) | PREDICTED: sister chromatid cohesion protein PDS5 homolog A | gi|470112954 | |
| Piper329 | GNFNAVRTGR | 166 | 15.59 | 2 | 1091.536 | [4] Deamidated (NQ) | PREDICTED: ribosome-recycling factor | chloroplastic isoform X1 | gi|743760069 |
| Piper334 | GPVILVIMSGGGMDVSFAKTNNK | 2189 | 22.67 | 2 | 2393.2121 | [N-term] Acetyl (N-term)|[13] Oxidation (M)|[21] Deamidated (NQ) | hypothetical protein PHAVU_002G206800g | gi|593792082 | |
| Piper335 | GQFTLVVVGLLVIAFVVPMAQYYAYVSK | 3117 | 16.42 | 2 | 3091.6667 | [19] Oxidation (M)|[21] Deamidated (NQ) | PREDICTED: UPF0603 protein Os05g0401100 | chloroplastic | gi|695009887 |
| Piper339 | GRNVVIDQDDVPK | 1429 | 13.48 | 2 | 1496.7357 | [N-term] Acetyl (N-term)|[8] Deamidated (NQ) | hypothetical protein SORBIDRAFT_02g011260 | gi|242043896 | |
| Piper343 | GTGTANQCPTIDGGVDSFAFK | 3244 | 16.73 | 2 | 2085.9068 | [7] Deamidated (NQ) | Oxygen-evolving enhancer protein 1 | gi|703126861 | |
| Piper344 | GTYSFYCSPHQGAGMVGK | 12462 | 16.16 | 2 | 1945.8455 | [7] Carbamidomethyl (C) | PREDICTED: plastocyanin | gi|225459768 | |
| Piper346 | GVEVTVNPQILK | 5394 | 7.81 | 2 | 1337.7668 | [N-term] Acetyl (N-term) | PREDICTED: subtilisin-like protease-like | gi|565344331 | |
| Piper347 | GVIIGILDTGIAPQHPSFNDNGMPNPPLKWK | 528 | 36.27 | 2 | 3383.7395 | [N-term] Acetyl (N-term)|[23] Oxidation (M) | PREDICTED: subtilisin-like protease-like | gi|565344331 | |
| Piper356 | GYKAILAMPATMSLER | 4318 | 28.35 | 2 | 1808.9055 | [N-term] Acetyl (N-term)|[8] Oxidation (M) | O-acetylserine (thiol)lyase family protein | gi|566169545 | |
| Piper360 | HIDTTITR | 5334 | 12.97 | 2 | 955.5082 | hypothetical protein SELMODRAFT_230659 | gi|302764140 | ||
| Piper364 | HMIEDDCADNGIPLPNVTSKILSK | 270 | 14.66 | 2 | 2725.2625 | [N-term] Acetyl (N-term)|[2] Oxidation (M)|[7] Carbamidomethyl (C)|[10] Deamidated (NQ) | PREDICTED: SKP1-like protein 1B | gi|225457883 | |
| Piper373 | IAPEEHPVLLTEAPLNPK | 7188 | 17.01 | 2 | 2010.0782 | [N-term] Acetyl (N-term)|[16] Deamidated (NQ) | actin 8 | gi|15222075 | |
| Piper408 | IKGYPIWGDPNR | 3661 | 25.79 | 2 | 1415.7257 | [11] Deamidated (NQ) | PREDICTED: glycerate dehydrogenase isoform X1 | gi|695029002 | |
| Piper410 | IKQEGNETSK | 2080 | 17 | 2 | 1176.5567 | [N-term] Acetyl (N-term)|[3] Deamidated (NQ)|[6] Deamidated (NQ) | PREDICTED: heat shock 70 kDa protein II-like | gi|470146512 | |
| Piper412 | IMTSGIISSDQAAVKR | 7208 | 20.84 | 2 | 1733.9189 | [N-term] Acetyl (N-term)|[2] Oxidation (M) | hypothetical protein CARUB_v10021924mg | gi|565487717 | |
| Piper413 | INEGKLLAK | 2452 | 19.59 | 2 | 985.58 | [2] Deamidated (NQ) | PREDICTED: kinesin-related protein 4- | gi|764627560 | |
| Piper417 | INTGDLADVR | 8741 | 35.15 | 2 | 1114.5618 | [N-term] Acetyl (N-term) | PREDICTED: NAC domain-containing protein 8 | gi|721616428 | |
| Piper425 | IRDGFK | 1019 | 11 | 2 | 734.4077 | PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g67720 | gi|769823987 | ||
| Piper439 | ITQIIGPVLDVVFPPGKMPYIYNALIVQGRDTVGKQINVTCEVQQLLGNNR | 800 | 16.46 | 2 | 5670.9176 | [N-term] Acetyl (N-term)|[3] Deamidated (NQ)|[23] Deamidated (NQ)|[28] Deamidated (NQ)|[36] Deamidat | ATP synthase CF1 beta subunit | chloroplast | gi|295136979 |
| Piper447 | IVLNDGFPLCLMQK | 2593 | 7.99 | 2 | 1590.8332 | [13] Deamidated (NQ) | PREDICTED: probable histone-lysine N-methyltransferase ATXR3 | gi|727530792 | |
| Piper452 | IVQIIGPVLDVAFQPGQMPNIYNALRVVASENIKDEVICEVQQLLGDHCVR | 2776 | 14.54 | 2 | 5744.9346 | [N-term] Acetyl (N-term)|[3] Deamidated (NQ)|[14] Deamidated (NQ)|[43] Deamidated (NQ)|[49] Carbamid | ATP synthase CF1 beta subunit | chloroplast | gi|806637011 |
| Piper457 | KAEAEMAAAKKASLTVK | 9788 | 9.96 | 2 | 1803.9907 | [N-term] Acetyl (N-term)|[6] Oxidation (M) | PREDICTED: uncharacterized protein LOC103409456 isoform X1 | gi|657950165 | |
| Piper458 | KANADLSHLPSNGGR | 915 | 29.5 | 2 | 1578.7905 | [N-term] Acetyl (N-term)|[12] Deamidated (NQ) | PREDICTED: ribulose bisphosphate carboxylase small chain | chloroplastic-like | gi|695032823 |
| Piper459 | KCCLSQPMGK | 3116 | 14.36 | 2 | 1093.5152 | PREDICTED: transcription factor GTE10 isoform X1 | gi|802648066 | ||
| Piper462 | KDSNRVACIINR | 5353 | 52.38 | 2 | 1430.7367 | [N-term] Acetyl (N-term)|[4] Deamidated (NQ) | PREDICTED: F-box protein At5g39250 | gi|470136931 | |
| Piper466 | KGNTYFLR | 9764 | 13.96 | 2 | 997.527 | ATP synthase gamma chain 1 family protein | gi|224078604 | ||
| Piper468 | KICLEPTSFTVK | 1925 | 15.82 | 2 | 1421.7581 | [3] Carbamidomethyl (C) | PREDICTED: oxygen-evolving enhancer protein 1 | chloroplastic | gi|702462073 |
| Piper474 | KLEEEVKK | 9917 | 27.1 | 2 | 1001.5754 | Plastid transcriptionally active 16 | gi|590588965 | ||
| Piper481 | KPFAAIVGGSKVSTKIGVIESLLAK | 693 | 5.62 | 2 | 2554.5108 | [N-term] Acetyl (N-term) | Os06g0668200 | gi|115469436 | |
| Piper482 | KPGCQGSAGGK | 11038 | 30.18 | 2 | 988.4772 | PREDICTED: uncharacterized protein DDB_G0286299-like | gi|658032420 | ||
| Piper488 | KTTESLTTESDEGCKKR | 3840 | 18.47 | 2 | 1911.9326 | hypothetical protein POPTR_0010s25180g | gi|224113355 | ||
| Piper490 | KVKISQSATTIIADVATKDEIQAR | 4609 | 15.35 | 2 | 2585.4217 | PREDICTED: ruBisCO large subunit-binding protein subunit alpha | chloroplastic-like | gi|573939233 | |
| Piper513 | LCLSLKEAGLHPQASLFVELN | 9311 | 38.42 | 2 | 2339.1925 | [2] Carbamidomethyl (C)|[13] Deamidated (NQ) | UBX domain-containing protein | putative | gi|255555707 |
| Piper514 | LDLGTSLMEKAKSK | 2345 | 22.02 | 2 | 1519.8153 | hypothetical protein CICLE_v10005101mg | gi|567859134 | ||
| Piper517 | LFDTIDNLDYAAKK | 627 | 14.62 | 2 | 1667.8392 | [N-term] Acetyl (N-term) | PREDICTED: oxygen-evolving enhancer protein 3-1 | chloroplastic | gi|727553557 |
| Piper530 | LGSAGSSSAMGSAMGSAMGSALGR | 384 | 32.41 | 2 | 2173.9309 | [N-term] Acetyl (N-term)|[10] Oxidation (M)|[14] Oxidation (M) | CAMKK/CAMKK-META protein kinase | gi|675191825 | |
| Piper531 | LGSSVGNVCDIGLPK | 4744 | 10.53 | 2 | 1458.7238 | [7] Deamidated (NQ) | PREDICTED: E3 ubiquitin-protein ligase RFWD3 | gi|470141070 | |
| Piper532 | LHPGGPFDPLGLAKDPDQAALLK | 2450 | 23.31 | 2 | 2412.2436 | [N-term] Acetyl (N-term)|[18] Deamidated (NQ) | Light harvesting complex of photosystem II 5 isoform 1 | gi|590602386 | |
| Piper535 | LIESQETDRGDRPK | 8933 | 21.91 | 2 | 1642.8283 | PREDICTED: peptidyl-prolyl cis-trans isomerase-like | gi|672203950 | ||
| Piper565 | LPPTLR | 8656 | 2.23 | 2 | 695.4307 | PREDICTED: protein TIC110 | chloroplastic-like | gi|502129546 | |
| Piper569 | LRPIPIGVSADLLVGQK | 8601 | 39.66 | 2 | 1775.0662 | PREDICTED: protease Do-like 1 | chloroplastic-like | gi|568832203 | |
| Piper570 | LRSIMNTYSK | 7472 | 16.37 | 2 | 1227.6165 | [5] Oxidation (M) | PREDICTED: probable histone-lysine N-methyltransferase ATXR3 | gi|727530792 | |
| Piper580 | LSIRVPNLNHLASKHR | 2406 | 15.76 | 2 | 1897.0569 | [N-term] Acetyl (N-term)|[7] Deamidated (NQ) | hypothetical protein PRUPE_ppa010759mg | gi|596004279 | |
| Piper597 | LVVADVAGLAPGTGTLTVFTNEK | 6009 | 36.5 | 2 | 2272.2213 | PREDICTED: aminomethyltransferase | mitochondrial | gi|659067712 | |
| Piper602 | MAAMNSSVLACNYAISGTASSELSKLASVPSAVFPTVSGPK | 1162 | 24.35 | 2 | 4117.0294 | [4] Oxidation (M)|[11] Carbamidomethyl (C)|[12] Deamidated (NQ) | Photosystem I reaction center subunit N, chloroplast precursor | putative | gi|255571379 |
| Piper603 | MAASLQAAATLMQPAKVGATGR | 2402 | 17.35 | 2 | 2218.1033 | [N-term] Acetyl (N-term)|[1] Oxidation (M)|[6] Deamidated (NQ)|[12] Oxidation (M) | PREDICTED: oxygen-evolving enhancer protein 1 | chloroplastic | gi|743794420 |
| Piper604 | MACESGQGCGAGQGCGTNACSSENLCSKDER | 5281 | 31.05 | 2 | 3112.1555 | [3] Carbamidomethyl (C)|[13] Deamidated (NQ)|[18] Deamidated (NQ)|[24] Deamidated (NQ) | predicted protein | gi|168012350 | |
| Piper605 | MAKGPVR | 2847 | 23.08 | 2 | 799.4342 | [N-term] Acetyl (N-term) | hypothetical protein PRUPE_ppa008435mg | gi|596298312 | |
| Piper607 | MASASPSLLK | 4064 | 8.09 | 2 | 1019.529 | [1] Oxidation (M) | hypothetical protein PHAVU_011G039100g | gi|593135502 | |
| Piper608 | MASLLLPPASSLLSPSSAAAASSSSSR | 1545 | 18.17 | 2 | 2561.3078 | [1] Oxidation (M) | PREDICTED: probable plastid-lipid-associated protein 6 | chloroplastic | gi|695064427 |
| Piper609 | MIGVWGMGGVGKTTLANQVAKNAEEDKLFEK | 1539 | 21.27 | 2 | 3364.6383 | [N-term] Acetyl (N-term)|[17] Deamidated (NQ)|[22] Deamidated (NQ) | PREDICTED: probable disease resistance protein At4g27220 | gi|731416899 | |
| Piper611 | MPAVQELVR | 1681 | 19.21 | 2 | 1083.5669 | [N-term] Acetyl (N-term) | PREDICTED: stromal 70 kDa heat shock-related protein | chloroplastic-like | gi|695033566 |
| Piper613 | MTPQTGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDR | 1423 | 22.2 | 2 | 3906.7776 | [1] Oxidation (M)|[4] Deamidated (NQ) | large subunit of Rubisco | chloroplast | gi|649132073 |
| Piper615 | MVSEAEKFAK | 7115 | 18.84 | 2 | 1196.5712 | [N-term] Acetyl (N-term)|[1] Oxidation (M) | PREDICTED: stromal 70 kDa heat shock-related protein | chloroplastic | gi|743943389 |
| Piper617 | NAGAEGPAVVEK | 3373 | 9.85 | 2 | 1141.5589 | [1] Deamidated (NQ) | hypothetical protein SORBIDRAFT_02g011260 | gi|242043896 | |
| Piper623 | NAVITVPAYFNDSQR | 8971 | 19.12 | 2 | 1736.85 | [N-term] Acetyl (N-term)|[1] Deamidated (NQ) | hypothetical protein PRUPE_ppa020538mg | partial | gi|595812189 |
| Piper624 | NAVVTVPAYFNNSQR | 4210 | 35.26 | 2 | 1679.8277 | [11] Deamidated (NQ) | PREDICTED: heat shock 70 kDa protein II-like | gi|470146512 | |
| Piper626 | NCAPIILR | 4724 | 14.37 | 2 | 955.5264 | [2] Carbamidomethyl (C) | PREDICTED: L-ascorbate peroxidase 2, cytosolic isoform X1 | gi|697132537 | |
| Piper630 | NDPNAAAAVSELR | 3237 | 18.33 | 2 | 1327.637 | [4] Deamidated (NQ) | PREDICTED: photosystem II repair protein PSB27-H1 | chloroplastic | gi|729448076 |
| Piper635 | NGITMIRNHIVSAAAAVTTQEGTIAQIIGPVCDVTFKAGNMPNIYDAVLVETK | 567 | 22.57 | 2 | 5670.9176 | [N-term] Acetyl (N-term)|[32] Carbamidomethyl (C)|[41] Oxidation (M)|[43] Deamidated (NQ) | CF1 beta subunit of ATP synthase | chloroplast | gi|699008381 |
| Piper637 | NGYPILIIAEDIEQEALATLVVNK | 8385 | 40.43 | 2 | 2625.4254 | PREDICTED: chaperonin 60 subunit beta 2 | chloroplastic | gi|697177711 | |
| Piper638 | NIGVLPSK | 1702 | 41.37 | 2 | 868.5014 | [N-term] Acetyl (N-term) | PREDICTED: transcription factor GTE10 isoform X1 | gi|802648066 | |
| Piper639 | NIIHFYNLANQAVEKGAGMDGQKITYTLIK | 2968 | 12 | 2 | 3366.7147 | [11] Deamidated (NQ)|[19] Oxidation (M) | hypothetical protein CICLE_v10030969mg | gi|567887676 | |
| Piper649 | NNAGFPHNVVFDEDEIPAGVDVSK | 8043 | 18.94 | 2 | 2569.209 | PREDICTED: plastocyanin A'/A'' | gi|697132031 | ||
| Piper660 | NSPPDFQKTKLMTR | 6739 | 12.33 | 2 | 1677.8369 | [12] Oxidation (M) | O2 evolving complex 33kD family protein | gi|224094610 | |
| Piper664 | NVRPDYLK | 7316 | 21.22 | 2 | 1003.5435 | superoxide dismutase [mn], | putative | gi|255559673 | |
| Piper675 | QGPNLLK | 1347 | 25.12 | 2 | 769.4334 | [1] Deamidated (NQ) | PREDICTED: photosystem I reaction center subunit II | chloroplastic-like | gi|672165549 |
| Piper678 | QHVSEDARSNGKGNKPMNGSPDRK | 6805 | 14.75 | 2 | 2668.2439 | [N-term] Acetyl (N-term)|[1] Deamidated (NQ)|[10] Deamidated (NQ)|[17] Oxidation (M) | PREDICTED: uncharacterized protein LOC101265024 | gi|460387039 | |
| Piper685 | QLDYVPSTIMVLEEVVK | 2894 | 17.08 | 2 | 1963.0016 | [1] Deamidated (NQ) | PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like | gi|747071890 | |
| Piper691 | QLVASGKPDK | 5497 | 15.44 | 2 | 1042.5776 | [1] Deamidated (NQ) | PREDICTED: oxygen-evolving enhancer protein 1 | chloroplastic | gi|225468761 |
| Piper694 | QLYGSQAILNQQHAFPVR | 3220 | 19.36 | 2 | 2072.0387 | [10] Deamidated (NQ)|[11] Deamidated (NQ)|[12] Deamidated (NQ) | hypothetical protein POPTR_0007s06770g | gi|224093896 | |
| Piper698 | QQLVELWMANGLISSNER | 5487 | 18.21 | 2 | 2090.0035 | [1] Deamidated (NQ)|[2] Deamidated (NQ)|[16] Deamidated (NQ) | PREDICTED: disease resistance protein RGA2-like isoform X2 | gi|571438506 | |
| Piper699 | QRIGIGAVRRGR | 2125 | 20.92 | 2 | 1338.7864 | [1] Deamidated (NQ) | PREDICTED: ferredoxin-dependent glutamate synthase | chloroplastic | gi|720066978 |
| Piper704 | QTTVQATGVASNLVEIIQGSGFK | 7709 | 49.46 | 2 | 2330.2126 | [N-term] Gln->pyro-Glu (N-term Q) | PREDICTED: uncharacterized protein LOC103706976 | gi|672131867 | |
| Piper712 | RAGVFEINNSTAFASK | 3491 | 16.93 | 2 | 1752.8792 | [N-term] Acetyl (N-term) | PREDICTED: uncharacterized protein LOC103439527 | gi|657969188 | |
| Piper715 | RATDVVVQVPNLQGGK | 3922 | 27.58 | 2 | 1722.9157 | [N-term] Acetyl (N-term)|[8] Deamidated (NQ) | hypothetical protein PHYSODRAFT_353200 | gi|695464043 | |
| Piper717 | RDVGNEIPK | 1751 | 11.7 | 2 | 1026.5493 | PREDICTED: uncharacterized protein LOC105173773 | gi|747092390 | ||
| Piper720 | RGNQQQGQSVSYRK | 7460 | 15.22 | 2 | 1678.7843 | [N-term] Acetyl (N-term)|[4] Deamidated (NQ)|[5] Deamidated (NQ) | PREDICTED: ruBisCO large subunit-binding protein subunit alpha | chloroplastic | gi|729443438 |
| Piper721 | RINNVSQQQQPLPFSLDSK | 2151 | 18.15 | 2 | 2243.1187 | [N-term] Acetyl (N-term)|[3] Deamidated (NQ)|[4] Deamidated (NQ)|[7] Deamidated (NQ) | PREDICTED: zinc finger protein KNUCKLES-like | gi|502106795 | |
| Piper723 | RNGITMIRNHIVSAAAAVTTQEGTIAQIIGPVCDVTFKAGNMPNIYDAVLVETK | 228 | 18.1 | 2 | 5728.9317 | [2] Deamidated (NQ)|[6] Oxidation (M)|[44] Deamidated (NQ) | CF1 beta subunit of ATP synthase | chloroplast | gi|699008381 |
| Piper726 | RQQAKAYFAK | 11211 | 35.1 | 2 | 1252.6659 | [N-term] Acetyl (N-term)|[2] Deamidated (NQ) | hypothetical protein SORBIDRAFT_05g002770 | gi|242069981 | |
| Piper731 | RVMPLR | 3283 | 19.77 | 2 | 770.4654 | PREDICTED: stromal 70 kDa heat shock-related protein | chloroplastic-like | gi|658008416 | |
| Piper734 | SAKFAAAGTEEKSKR | 10112 | 15.16 | 2 | 1621.8392 | [N-term] Acetyl (N-term) | hypothetical protein POPTR_0010s25180g | gi|224113355 | |
| Piper740 | SFANAPCIRLNIHKDFVSCRVAISLVK | 5340 | 45.13 | 2 | 3001.5969 | [11] Deamidated (NQ) | predicted protein | gi|168016236 | |
| Piper753 | SKPESGEVIGVFESIQPSDTDLGAK | 3957 | 17.68 | 2 | 2589.283 | PREDICTED: oxygen-evolving enhancer protein 1 | chloroplastic | gi|586769243 | |
| Piper757 | SLILMDLSYNRLSGPLPISIR | 3324 | 16.6 | 2 | 2416.311 | [N-term] Acetyl (N-term)|[5] Oxidation (M)|[10] Deamidated (NQ) | PREDICTED: protein TOO MANY MOUTHS | gi|719981575 | |
| Piper767 | SSAKEIAFDQHSRRALQAGIDK | 2713 | 13.51 | 2 | 2429.2445 | [10] Deamidated (NQ)|[17] Deamidated (NQ) | PREDICTED: ruBisCO large subunit-binding protein subunit alpha | gi|694332515 | |
| Piper771 | SSLQAGVEKLASAVGVTLGPR | 5369 | 26.94 | 2 | 2081.1481 | [N-term] Acetyl (N-term) | PREDICTED: ruBisCO large subunit-binding protein subunit alpha | chloroplastic-like | gi|573939233 |
| Piper772 | SSSYNADGSSR | 1513 | 14.88 | 2 | 1130.4562 | [5] Deamidated (NQ) | PREDICTED: protein UPSTREAM OF FLC-like | gi|729344843 | |
| Piper773 | STAELEEEMMAKIPK | 7160 | 19.42 | 2 | 1763.8344 | [N-term] Acetyl (N-term)|[10] Oxidation (M) | PREDICTED: LOW QUALITY PROTEIN: protein TPX2 | gi|657979269 | |
| Piper779 | SVYEPLQTGLVAVDAMIPIGRGQR | 2869 | 11.55 | 2 | 2586.3588 | [7] Deamidated (NQ)|[16] Oxidation (M) | ATP synthase CF1 alpha subunit | chloroplast | gi|108773075 |
| Piper781 | SYADNANALKAQLDQQK | 3995 | 15.65 | 2 | 1920.8893 | [N-term] Acetyl (N-term)|[12] Deamidated (NQ)|[16] Deamidated (NQ) | PREDICTED: membrane-associated 30 kDa protein | chloroplastic | gi|449468854 |
| Piper783 | TAAGVQLRSSSHLTK | 4518 | 15.07 | 2 | 1597.855 | [N-term] Acetyl (N-term)|[6] Deamidated (NQ) | PREDICTED: oxygen-evolving enhancer protein 1 | chloroplastic-like | gi|695080434 |
| Piper789 | TALQSGIDK | 2172 | 17.48 | 2 | 931.4973 | PREDICTED: ruBisCO large subunit-binding protein subunit alpha | gi|449456032 | ||
| Piper794 | TEEGARAALAEPMKNIDGHQVTCK | 8043 | 14.93 | 2 | 2569.209 | [15] Deamidated (NQ) | PREDICTED: UBP1-associated protein 2C-like | gi|470115498 | |
| Piper796 | TFLTSDVVVVDIKEEFIPTGAAQGMAMDNSGYPPY | 4795 | 18.76 | 2 | 3835.7941 | [N-term] Acetyl (N-term)|[25] Oxidation (M)|[27] Oxidation (M) | hypothetical protein SELMODRAFT_168153 | gi|302765539 | |
| Piper801 | TIAECLADELINAAK | 8248 | 11.43 | 2 | 1616.8044 | [N-term] Acetyl (N-term)|[12] Deamidated (NQ) | Os01g0100700 | gi|115433960 | |
| Piper802 | TIARPDVAEVCIQALQFEEAK | 6960 | 44.19 | 2 | 2387.2136 | [11] Carbamidomethyl (C) | PREDICTED: uncharacterized protein At5g02240-like | gi|657956853 | |
| Piper809 | TMSFQPFLNSNNKNPNFTSPPLK | 6452 | 17.17 | 2 | 2626.2338 | [11] Deamidated (NQ)|[12] Deamidated (NQ)|[14] Deamidated (NQ)|[16] Deamidated (NQ) | PREDICTED: F-box protein At5g07670-like | gi|502178851 | |
| Piper820 | TSDPLEEYCKDNPETDECRTYED | 3003 | 12.98 | 2 | 2851.1102 | [N-term] Acetyl (N-term)|[12] Deamidated (NQ)|[18] Carbamidomethyl (C) | PREDICTED: calvin cycle protein CP12-1 | chloroplastic-like | gi|694998271 |
| Piper828 | TVGAGVIQK | 2449 | 18.01 | 2 | 913.5234 | [N-term] Acetyl (N-term) | PREDICTED: elongation factor TuA, | chloroplastic-like | gi|565355181 |
| Piper831 | TVKALVSELKSMSK | 5905 | 9.53 | 2 | 1577.8776 | [N-term] Acetyl (N-term)|[12] Oxidation (M) | PREDICTED: ruBisCO large subunit-binding protein subunit beta | chloroplastic | gi|731322356 |
| Piper837 | VAAAAAASSVAR | 2063 | 86.58 | 2 | 1043.5717 | Putative DUF21 domain-containing protein | gi|703076596 | ||
| Piper841 | VAIMPPVPNK | 6142 | 20.18 | 2 | 1065.5818 | [9] Deamidated (NQ) | PREDICTED: uncharacterized protein LOC103437671 | gi|657965456 | |
| Piper843 | VAITISPR | 54 | 26.78 | 2 | 855.5175 | ATP-dependent clp protease ATP-binding subunit clpA family protein | gi|224136316 | ||
| Piper850 | VDLNVPLDDNFNITDDTR | 1044 | 17.86 | 2 | 2075.9413 | [10] Deamidated (NQ) | cytosolic phosphoglycerate kinase family protein | gi|224109062 | |
| Piper879 | VISAGMNPVQIARGIDK | 3138 | 20.25 | 2 | 1811.9486 | [N-term] Acetyl (N-term)|[7] Deamidated (NQ)|[10] Deamidated (NQ) | Chaperonin 60 subunit beta 4 | gi|703081381 | |
| Piper880 | VKKAIIGK | 1468 | 3.29 | 2 | 897.6019 | [N-term] Acetyl (N-term) | PREDICTED: calponin homology domain-containing protein DDB_G0272472-like isoform X | gi|694324955 | |
| Piper881 | VKVGNEVVR | 2521 | 24 | 2 | 999.5705 | [5] Deamidated (NQ) | huntingtin interacting protein | putative | gi|255558564 |
| Piper883 | VLDLSNVCLTR | 1758 | 19.73 | 2 | 1274.649 | [N-term] Acetyl (N-term)|[6] Deamidated (NQ) | PREDICTED: probable disease resistance protein At4g27220 | gi|731416899 | |
| Piper917 | VTAICVMGGLGK | 863 | 21.44 | 2 | 1163.617 | [7] Oxidation (M) | hypothetical protein ARALYDRAFT_474150 | gi|297847358 | |
| Piper932 | VVGVDTSGEGVK | 6963 | 36.94 | 2 | 1145.5927 | PREDICTED: dihydrolipoyl dehydrogenase 1 | mitochondrial | gi|719988361 | |
| Piper935 | VVMALNISQIPNVTK | 4732 | 16.89 | 2 | 1626.8838 | [12] Deamidated (NQ) | PREDICTED: probable disease resistance protein At4g27220 | gi|731416899 | |
| Piper949 | YAVFGYVTENEDYLADLK | 10802 | 26.6 | 2 | 2108.9911 | PREDICTED: peptidyl-prolyl cis-trans isomerase CYP38 | chloroplastic-like | gi|743926702 | |
| Piper950 | YEKVGTIK | 5284 | 3.87 | 2 | 936.5389 | cytochrome b5 domain-containing family protein | gi|224134737 | ||
| Piper951 | YFCTAAPQPWLFVGLGNPGNK | 1674 | 11.64 | 2 | 2281.1133 | [8] Deamidated (NQ)|[17] Deamidated (NQ) | hypothetical protein PRUPE_ppa011211mg | gi|595829406 | |
| Piper953 | YIHGDLKPSNILIGQDMEPK | 650 | 20.12 | 2 | 2309.1842 | [N-term] Acetyl (N-term) | hypothetical protein ARALYDRAFT_484030 | gi|297817706 | |
| Piper955 | YMALTELQER | 3084 | 14.91 | 2 | 1295.6144 | [N-term] Acetyl (N-term)|[8] Deamidated (NQ) | hypothetical protein PRUPE_ppa003142mg | gi|595817464 | |
| Piper972 | GICVPIRCPGSMRQIGTCLGAQVK | 1173 | 10.45 | 2 | 2602.2562 | [N-term] Acetyl|[8] Carbamidomethyl|[12] Oxidation|[22] Deamidated | Ar-AMP | Leaf | AP00401 |
| Piper973 | GICVPIRCPGSMRQIGTCLGAQVK | 1173 | 10.45 | 2 | 2602.2562 | [N-term] Acetyl|[12] Oxidation|[18] Carbamidomethyl|[22] Deamidated | Ar-AMP | Leaf | AP00401 |
| Piper974 | QIGTCLGAQVKCCR | 4669 | 10.1 | 2 | 1649.7805 | [5] Carbamidomethyl|[12] Carbamidomethyl|[13] Carbamidomethyl | Ar-AMP | Leaf | AP00401 |
| Piper977 | CAPKMKQIGTCGMPQVKCCK | 287 | 10.63 | 2 | 2226.0018 | [5] Oxidation|[11] Carbamidomethyl | Floral defensin-like protein 2 (PhD2) | Leaf | AP01597 |
| Piper978 | CAPKMKQIGTCGMPQVKCCK | 287 | 14.64 | 2 | 2226.0018 | [11] Carbamidomethyl|[13] Oxidation | Floral defensin-like protein 2 (PhD2) | Leaf | AP01597 |
| Piper979 | SVSCLRNK | 10008 | 15.09 | 2 | 963.4762 | [4] Carbamidomethyl|[7] Deamidated | Floral defensin-like protein 2 (PhD2) | Leaf | AP01597 |
| Piper988 | SCCRSTQARNIYNAPR | 4653 | 22.56 | 2 | 1897.8383 | [2] Carbamidomethyl|[7] Deamidated|[10] Deamidated | Pp-AMP1 | Leaf | AP01585 |
| Piper989 | SCCRSTQARNIYNAPR | 4653 | 22.56 | 2 | 1897.8383 | [3] Carbamidomethyl|[7] Deamidated|[10] Deamidated | Pp-AMP1 | Leaf | AP01585 |
| Piper992 | GQVNDSACAANCLSLGKAGGHCEK | 979 | 21.12 | 2 | 2332.0176 | Gamma-2-purothionin | Leaf | AP00226 | |
| Piper995 | NKGICVPIR | 9157 | 17.77 | 2 | 998.5754 | Antifungal protein AX1 | Leaf | AP00235 | |
| Piper996 | GIKDWIK | 4947 | 15.31 | 2 | 900.5037 | [N-term] Acetyl | Rc-LTP C (CB-C) | Leaf | AP01220 |
| Piper997 | ALGTLLK | 2017 | 12.19 | 2 | 756.4833 | [N-term] Acetyl | thionin Osthi1 | Leaf | AP00909 |