PiperID Sequence Ion Score Hits Mass Modification Protein Name Origin Accession

Showing results for Hits = 2

PiperIDSEQUENCEIonScoreHitsMassModificationProtein NameOriginAccession
Piper2 AADELRKEGKTVR 7382 11.59 2 1513.8205 [N-term] Acetyl (N-term) Os06g0133800 partial gi|115466224
Piper22 AFVVHELQDDLGKGGHELSLTTGNAGGR 4339 43.88 2 2878.4214 [8] Deamidated (NQ) PREDICTED: superoxide dismutase [Cu-Zn], chloroplastic gi|672175294
Piper25 AGGAVPYSDMTPLQAAVGVVQKGLRPGIPLNCPLPLAELMEACWAGNPVQRPSFR 2776 31.06 2 5744.9346 [14] Deamidated (NQ)|[21] Deamidated (NQ)|[31] Deamidated (NQ) hypothetical protein VOLCADRAFT_64912 gi|302845911
Piper26 AGGYSSDGTQSVLDK 5462 56.89 2 1483.6767 PREDICTED: sedoheptulose-1,7-bisphosphatase chloroplastic gi|720002409
Piper29 AGPAAAAR 374 11.55 2 683.3645 hypothetical protein PHAVU_008G011300g partia gi|593331584
Piper35 AIFVDLEPTVIDEVR 7383 35.07 2 1714.9101 Os07g0574800 gi|115472953
Piper36 AIGAAGSGGGGAASSGGSGSGSGSHHHQDASR 3024 31.87 2 2733.1886 [N-term] Acetyl (N-term) Os07g0606600 gi|115473263
Piper39 AINQVRQRVFQQALQGALGTLNSCLNK 1000 16.71 2 3013.5966 [N-term] Acetyl (N-term)|[15] Deamidated (NQ)|[22] Deamidated (NQ) ATP synthase CF0 subunit I chloroplast gi|114329642
Piper40 AIQQAVVSMKR 5645 18.63 2 1289.6714 [N-term] Acetyl (N-term)|[3] Deamidated (NQ)|[4] Deamidated (NQ)|[9] Oxidation (M) PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103444373 gi|657979140
Piper41 AIRVNVAEERPR 1324 13.6 2 1408.8041 PREDICTED: 28 kDa ribonucleoprotein chloroplastic-like gi|225452270
Piper43 AITVRRGK 5764 18.75 2 941.5766 [N-term] Acetyl (N-term) PREDICTED: uncharacterized protein LOC103439527 gi|657969188
Piper47 ALALGASGIFIGR 3852 61.01 2 1244.7229 PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like gi|747071890
Piper48 ALDSQIAALSQDIVK 2904 33.48 2 1571.8498 [11] Deamidated (NQ) PREDICTED: ATP synthase subunit b' chloroplastic gi|769797378
Piper55 ALLVRAAQQTADRR 2129 35.05 2 1568.8919 [9] Deamidated (NQ) hypothetical protein SORBIDRAFT_02g004390 gi|242047582
Piper67 ANVKEISFDQSSR 7770 8.09 2 1522.7141 [N-term] Acetyl (N-term)|[10] Deamidated (NQ) PREDICTED: ruBisCO large subunit-binding protein subunit alpha chloroplastic gi|685300202
Piper76 AQVTTETPAK 7578 15.07 2 1044.5333 PREDICTED: ferredoxin--NADP reductase, leaf isozyme chloroplastic gi|672129741
Piper77 ARLVVVQQQQQR 4206 15.18 2 1451.835 PREDICTED: chloroplast stem-loop binding protein of 41 kDa b chloroplastic isoform X4 gi|645221761
Piper79 ARSAISSQKSLSGNFK 4630 11.5 2 1722.91 [N-term] Acetyl (N-term)|[14] Deamidated (NQ) Ribulose bisphosphate carboxylase/oxygenase activase gi|357469233
Piper82 ASANAISTASILRSASPR 6752 23.99 2 1813.9683 [N-term] Acetyl (N-term) PREDICTED: ruBisCO large subunit-binding protein subunit alpha gi|695074715
Piper85 ASLTQSAVFGKK 4620 13.9 2 1278.6822 [N-term] Acetyl (N-term)|[5] Deamidated (NQ) psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving enhancer 1 gi|145356482
Piper97 AVITVPAYFNDSQR 1988 36.03 2 1579.7982 PREDICTED: heat shock 70 kDa protein 6 chloroplastic gi|685259957
Piper98 AVQLSPSTPELFGK 1032 11.8 2 1514.8137 [N-term] Acetyl (N-term) PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like gi|702344661
Piper101 AVVQVFEGTSGIDNK 6169 81.56 2 1562.7984 hypothetical protein CICLE_v10028070mg gi|567859772
Piper109 CARCWVRGSMR 5593 17.66 2 1323.6162 PREDICTED: aspartate aminotransferase cytoplasmic-like gi|702301738
Piper110 CCSGNSNNIRENKQRGTFSSLK 5022 20.74 2 2603.094 [N-term] Acetyl (N-term)|[1] Carbamidomethyl (C)|[2] Carbamidomethyl (C)|[5] Deamidated (NQ)|[7] Dea hypothetical protein CARUB_v10013720mg gi|565480100
Piper112 CGGGGGNCGSQCGGENMANSGACGGCGGGCGGKNIANSGACGGCGGGCGSGCGGGGGGNCGGGCGGGCR 447 17.51 2 5842.9826 [N-term] Acetyl (N-term)|[16] Deamidated (NQ)|[19] Deamidated (NQ)|[30] Carbamidomethyl (C)|[34] Dea PREDICTED: uncharacterized protein LOC103426317 gi|658053745
Piper113 CGQARGDVEQLLR 3167 53.56 2 1443.7364 uncharacterized protein LOC100277671 gi|226533298
Piper127 DGFEQKLLQKVIIEVLPEWSTK 6002 12.55 2 2642.4415 [N-term] Acetyl (N-term)|[5] Deamidated (NQ) diaminohydroxyphosphoribosylaminopyrimidine deaminase gi|18415600
Piper129 DGQLGHGYNEPGCSRPR 7303 40.4 2 1884.7951 [N-term] Acetyl (N-term)|[3] Deamidated (NQ) hypothetical protein COCSUDRAFT_83510 partial gi|545362013
Piper132 DIELVMTQAGVSRSK 8333 20.51 2 1633.8401 [8] Deamidated (NQ) PREDICTED: nascent polypeptide-associated complex subunit alpha-like protein 1 gi|225470846
Piper134 DIYSALNAVSGHYISFGPTAPIPSK 5443 50.54 2 2604.3252 PREDICTED: photosystem II repair protein PSB27-H1 chloroplastic gi|729448076
Piper136 DIYSALNAVSGHYISFGPTSPIPAK 5443 50.83 2 2604.3252 PREDICTED: photosystem II repair protein PSB27-H1 chloroplastic gi|802754235
Piper141 DMRQTVAVGVIK 4006 21.33 2 1331.7233 [2] Oxidation (M) elongation factor alpha3 gi|162460570
Piper145 DNPLGVKAMKR 1248 14.76 2 1243.6784 [9] Oxidation (M) PREDICTED: low-temperature-induced cysteine proteinase gi|747056289
Piper146 DSDNNLTEEDKRKLEK 4898 30.5 2 1974.9648 [N-term] Acetyl (N-term) Translocon at the outer envelope membrane of chloroplasts 159 gi|590567110
Piper154 DVFAGIDPDLDSQVEFGTFQK 6522 76.99 2 2327.0985 photosystem II CP47 chlorophyll apoprotein chloroplast gi|115605047
Piper158 EACSYCVEMIEMDFMMQPDTFAKLMK 242 30.94 2 3164.2757 [N-term] Acetyl (N-term)|[15] Oxidation (M)|[16] Oxidation (M) PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820 gi|685321387
Piper167 ECHPEESVSADTTTVDVEK 2144 17.33 2 2116.9115 [N-term] Acetyl (N-term) PREDICTED: zinc finger CCCH domain-containing protein 48-like gi|731352925
Piper168 EDDIVGILETDDIKDLKPLNDR 5825 25.71 2 2525.2889 20 kDa chaperonin family protein gi|224141565
Piper174 EGNEIIRRAIR 522 12.11 2 1308.7403 [N-term] Glu->pyro-Glu (N-term E)|[3] Deamidated (NQ) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit chloroplast gi|218176252
Piper176 EGNFDLVGINFPVFFIR 2708 55.91 2 1983.9865 [3] Deamidated (NQ) PREDICTED: catalase isozyme 2-like isoform X1 gi|702368491
Piper179 EGPPTFNQPK 5799 8.27 2 1114.5276 [8] Deamidated (NQ) hypothetical protein PRUPE_ppa005184mg gi|595823869
Piper186 EIILPTNSGQIGVLPNHAPIATAVDIGILR 4951 21.77 2 3093.6962 [10] Deamidated (NQ)|[16] Deamidated (NQ) ATP synthase CF1 epsilon subunit chloroplast gi|115605028
Piper194 EITLGFVDLLRDDFVEKDR 1577 16.45 2 2279.179 ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit plastid gi|752789999
Piper197 EKIGSGLVIASMVLQLQASCSK 1623 47.23 2 2376.2639 [N-term] Acetyl (N-term)|[12] Oxidation (M)|[20] Carbamidomethyl (C) PREDICTED: uncharacterized protein LOC103842403 gi|685366435
Piper198 EKLQFNPQQVK 7831 23.01 2 1358.7267 [9] Deamidated (NQ) PREDICTED: probable WRKY transcription factor 74 [Malus gi|658020681
Piper201 ELCKSINPDEAVAYGAAVQAALLSK 1749 16.8 2 2661.3408 [N-term] Acetyl (N-term)|[3] Carbamidomethyl (C)|[7] Deamidated (NQ)|[19] Deamidated (NQ) Heat shock protein gi|357448685
Piper203 ELEENCKNMTDQLNEPILK 368 21.16 2 2260.0336 [N-term] Glu->pyro-Glu (N-term E)|[5] Deamidated (NQ)|[8] Deamidated (NQ)|[9] Oxidation (M) PREDICTED: polynucleotide 3'-phosphatase ZDP-like gi|573913994
Piper205 ELGLTVENVIATAK 3400 47.57 2 1456.8088 Os04g0266900 gi|115457470
Piper212 ELVAEGKPEKFGGSFLVPSYR 650 19.31 2 2309.1842 predicted protein gi|168021458
Piper217 EPKFLKNGDAGYVK 3021 17.04 2 1606.8216 [N-term] Acetyl (N-term) PREDICTED: elongation factor 1-alpha isoform 2 gi|356558809
Piper218 EQCLALGTRLRSKYK 12993 5.28 2 1803.9896 [N-term] Glu->pyro-Glu (N-term E)|[3] Carbamidomethyl (C) photosystem I reaction center subunit D-2 gi|15218708
Piper221 EQSGESSAVDSSLLTK 4136 20.36 2 1678.7843 [N-term] Acetyl (N-term) hypothetical protein POPTR_0002s02860g gi|566155930
Piper222 EQVEVRNSADSMVYQTEK 9022 9.99 2 2171.9521 [N-term] Acetyl (N-term)|[2] Deamidated (NQ)|[12] Oxidation (M)|[15] Deamidated (NQ) Heat Shock Protein 70 chloroplast gi|145342483
Piper230 ETDVLAAFR 14970 25.43 2 1002.5127 [N-term] Glu->pyro-Glu (N-term E) large subunit of Rubisco chloroplast gi|649132073
Piper232 ETGYLQDLVYK 67 22.78 2 1328.6612 [6] Deamidated (NQ) Thylakoid lumenal 16.5 kDa protein gi|357478143
Piper234 ETTTIVGDGSTQEAVNKR 2946 29.45 2 1904.9438 TCP-1/cpn60 chaperonin family protein gi|590619306
Piper239 EYKPDLNIVSNASCTTNCLAPLAK 283 21.27 2 2664.2484 [N-term] Acetyl (N-term)|[14] Carbamidomethyl (C)|[17] Deamidated (NQ) glyceraldehyde 3-phosphate dehydrogenase family protein gi|224055669
Piper241 FDHVVVAIEESR 7232 31.69 2 1441.71 [N-term] Acetyl (N-term) PREDICTED: uncharacterized protein LOC102666468 gi|571561753
Piper242 FDIDANGILSVTAVDK 6823 51.17 2 1677.8545 [6] Deamidated (NQ) Chloroplast heat shock protein 70 isoform 1 gi|590654488
Piper250 FGLETSPINTK 1738 34.07 2 1205.6303 hypothetical protein POPTR_0003s02470g gi|566160475
Piper252 FIVINMQVGIIMYLPTSDAR 11758 38.75 2 2339.1931 [N-term] Acetyl (N-term)|[5] Deamidated (NQ)|[12] Oxidation (M) Os12g0139600 gi|297612641
Piper260 FNKVNYAGVSTNNYALDEILEVK 10621 14.34 2 2602.2556 [2] Deamidated (NQ)|[13] Deamidated (NQ) photosystem I reaction center subunit IV A gi|226503797
Piper261 FNNKASKSR 7981 17.72 2 1050.5471 PREDICTED: ruBisCO large subunit-binding protein subunit alpha chloroplastic-like gi|460391345
Piper266 FVAQGAYDSR 4094 15.13 2 1112.5249 hypothetical protein CICLE_v10028070mg gi|567859772
Piper286 GGERLVGQIAK 2730 14.36 2 1127.6187 [8] Deamidated (NQ) Os12g0244100 gi|115487998
Piper287 GGGKGARGVVSMAKK 617 9.58 2 1401.7978 PREDICTED: phosphoglycerate kinase chloroplastic-like gi|356525742
Piper289 GGKGARGVVSMAKK 336 10.46 2 1344.7766 PREDICTED: phosphoglycerate kinase chloroplastic gi|356557028
Piper291 GGSSSSGGGCCSGSSMTLDCSGVR 5871 24.04 2 2252.8618 [N-term] Acetyl (N-term)|[16] Oxidation (M)|[20] Carbamidomethyl (C) RegA-like protein RlsG gi|302842281
Piper300 GGVVSGAADQRRK 6373 16.01 2 1300.7001 [10] Deamidated (NQ) PREDICTED: disease resistance protein At4g27190-like gi|702487157
Piper304 GILAADESTGTIGKR 7233 19.77 2 1487.7946 Os08g0120600 gi|115474567
Piper306 GINMAVDTVVTNLK 1610 15.19 2 1490.7735 [3] Deamidated (NQ)|[4] Oxidation (M) PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform 1 gi|356535474
Piper311 GKGGKGMGK 2279 20.06 2 876.4494 [N-term] Acetyl (N-term)|[7] Oxidation (M) PREDICTED: LOW QUALITY PROTEIN: histone H4-like gi|658048037
Piper312 GLCGGFNNNIIKKAEARIAELK 2612 14.16 2 2400.2809 [N-term] Acetyl (N-term) PREDICTED: ATP synthase gamma chain chloroplastic gi|702351843
Piper313 GLDTSVNGPGVK 12957 11.69 2 1143.5883 [7] Deamidated (NQ) Beta-fructofuranosidase, soluble isoenzyme I precursor putative gi|255539759
Piper322 GLVPLAGSNDESWCQGLDGLASR 5495 35.93 2 2401.1362 [14] Carbamidomethyl (C) PREDICTED: fructose-bisphosphate aldolase 1 chloroplastic gi|747082340
Piper323 GMEVIDTGAPLSVPVGGTTLGR 6789 8.57 2 2142.101 [2] Oxidation (M) ATP synthase CF1 beta subunit chloroplast gi|323149089
Piper324 GMEVIDTGTALSVPVGGATLGR 6789 21.23 2 2142.101 [N-term] Acetyl (N-term) ATP synthase beta subunit chloroplast gi|119368506
Piper325 GMEVIDTGTPLSVPVGGATLGR 6789 51.87 2 2142.101 [2] Oxidation (M) ATP synthase CF1 beta subunit chloroplast gi|139387437
Piper326 GMQVIDTGTPLSVPVGGATLGR 6789 55.7 2 2142.101 [2] Oxidation (M)|[3] Deamidated (NQ) ATP synthase CF1 beta subunit chloroplast gi|393396089
Piper327 GMVDSLFQAPTGTGTHHAVLQSYEYVSQGLR 2218 22.12 2 3392.5828 [N-term] Acetyl (N-term)|[8] Deamidated (NQ)|[21] Deamidated (NQ) PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 1 chloroplastic isoform X1 gi|697180392
Piper328 GNDPEDMQK 13278 21.89 2 1092.3941 [N-term] Acetyl (N-term)|[2] Deamidated (NQ)|[7] Oxidation (M)|[8] Deamidated (NQ) PREDICTED: sister chromatid cohesion protein PDS5 homolog A gi|470112954
Piper329 GNFNAVRTGR 166 15.59 2 1091.536 [4] Deamidated (NQ) PREDICTED: ribosome-recycling factor chloroplastic isoform X1 gi|743760069
Piper334 GPVILVIMSGGGMDVSFAKTNNK 2189 22.67 2 2393.2121 [N-term] Acetyl (N-term)|[13] Oxidation (M)|[21] Deamidated (NQ) hypothetical protein PHAVU_002G206800g gi|593792082
Piper335 GQFTLVVVGLLVIAFVVPMAQYYAYVSK 3117 16.42 2 3091.6667 [19] Oxidation (M)|[21] Deamidated (NQ) PREDICTED: UPF0603 protein Os05g0401100 chloroplastic gi|695009887
Piper339 GRNVVIDQDDVPK 1429 13.48 2 1496.7357 [N-term] Acetyl (N-term)|[8] Deamidated (NQ) hypothetical protein SORBIDRAFT_02g011260 gi|242043896
Piper343 GTGTANQCPTIDGGVDSFAFK 3244 16.73 2 2085.9068 [7] Deamidated (NQ) Oxygen-evolving enhancer protein 1 gi|703126861
Piper344 GTYSFYCSPHQGAGMVGK 12462 16.16 2 1945.8455 [7] Carbamidomethyl (C) PREDICTED: plastocyanin gi|225459768
Piper346 GVEVTVNPQILK 5394 7.81 2 1337.7668 [N-term] Acetyl (N-term) PREDICTED: subtilisin-like protease-like gi|565344331
Piper347 GVIIGILDTGIAPQHPSFNDNGMPNPPLKWK 528 36.27 2 3383.7395 [N-term] Acetyl (N-term)|[23] Oxidation (M) PREDICTED: subtilisin-like protease-like gi|565344331
Piper356 GYKAILAMPATMSLER 4318 28.35 2 1808.9055 [N-term] Acetyl (N-term)|[8] Oxidation (M) O-acetylserine (thiol)lyase family protein gi|566169545
Piper360 HIDTTITR 5334 12.97 2 955.5082 hypothetical protein SELMODRAFT_230659 gi|302764140
Piper364 HMIEDDCADNGIPLPNVTSKILSK 270 14.66 2 2725.2625 [N-term] Acetyl (N-term)|[2] Oxidation (M)|[7] Carbamidomethyl (C)|[10] Deamidated (NQ) PREDICTED: SKP1-like protein 1B gi|225457883
Piper373 IAPEEHPVLLTEAPLNPK 7188 17.01 2 2010.0782 [N-term] Acetyl (N-term)|[16] Deamidated (NQ) actin 8 gi|15222075
Piper408 IKGYPIWGDPNR 3661 25.79 2 1415.7257 [11] Deamidated (NQ) PREDICTED: glycerate dehydrogenase isoform X1 gi|695029002
Piper410 IKQEGNETSK 2080 17 2 1176.5567 [N-term] Acetyl (N-term)|[3] Deamidated (NQ)|[6] Deamidated (NQ) PREDICTED: heat shock 70 kDa protein II-like gi|470146512
Piper412 IMTSGIISSDQAAVKR 7208 20.84 2 1733.9189 [N-term] Acetyl (N-term)|[2] Oxidation (M) hypothetical protein CARUB_v10021924mg gi|565487717
Piper413 INEGKLLAK 2452 19.59 2 985.58 [2] Deamidated (NQ) PREDICTED: kinesin-related protein 4- gi|764627560
Piper417 INTGDLADVR 8741 35.15 2 1114.5618 [N-term] Acetyl (N-term) PREDICTED: NAC domain-containing protein 8 gi|721616428
Piper425 IRDGFK 1019 11 2 734.4077 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g67720 gi|769823987
Piper439 ITQIIGPVLDVVFPPGKMPYIYNALIVQGRDTVGKQINVTCEVQQLLGNNR 800 16.46 2 5670.9176 [N-term] Acetyl (N-term)|[3] Deamidated (NQ)|[23] Deamidated (NQ)|[28] Deamidated (NQ)|[36] Deamidat ATP synthase CF1 beta subunit chloroplast gi|295136979
Piper447 IVLNDGFPLCLMQK 2593 7.99 2 1590.8332 [13] Deamidated (NQ) PREDICTED: probable histone-lysine N-methyltransferase ATXR3 gi|727530792
Piper452 IVQIIGPVLDVAFQPGQMPNIYNALRVVASENIKDEVICEVQQLLGDHCVR 2776 14.54 2 5744.9346 [N-term] Acetyl (N-term)|[3] Deamidated (NQ)|[14] Deamidated (NQ)|[43] Deamidated (NQ)|[49] Carbamid ATP synthase CF1 beta subunit chloroplast gi|806637011
Piper457 KAEAEMAAAKKASLTVK 9788 9.96 2 1803.9907 [N-term] Acetyl (N-term)|[6] Oxidation (M) PREDICTED: uncharacterized protein LOC103409456 isoform X1 gi|657950165
Piper458 KANADLSHLPSNGGR 915 29.5 2 1578.7905 [N-term] Acetyl (N-term)|[12] Deamidated (NQ) PREDICTED: ribulose bisphosphate carboxylase small chain chloroplastic-like gi|695032823
Piper459 KCCLSQPMGK 3116 14.36 2 1093.5152 PREDICTED: transcription factor GTE10 isoform X1 gi|802648066
Piper462 KDSNRVACIINR 5353 52.38 2 1430.7367 [N-term] Acetyl (N-term)|[4] Deamidated (NQ) PREDICTED: F-box protein At5g39250 gi|470136931
Piper466 KGNTYFLR 9764 13.96 2 997.527 ATP synthase gamma chain 1 family protein gi|224078604
Piper468 KICLEPTSFTVK 1925 15.82 2 1421.7581 [3] Carbamidomethyl (C) PREDICTED: oxygen-evolving enhancer protein 1 chloroplastic gi|702462073
Piper474 KLEEEVKK 9917 27.1 2 1001.5754 Plastid transcriptionally active 16 gi|590588965
Piper481 KPFAAIVGGSKVSTKIGVIESLLAK 693 5.62 2 2554.5108 [N-term] Acetyl (N-term) Os06g0668200 gi|115469436
Piper482 KPGCQGSAGGK 11038 30.18 2 988.4772 PREDICTED: uncharacterized protein DDB_G0286299-like gi|658032420
Piper488 KTTESLTTESDEGCKKR 3840 18.47 2 1911.9326 hypothetical protein POPTR_0010s25180g gi|224113355
Piper490 KVKISQSATTIIADVATKDEIQAR 4609 15.35 2 2585.4217 PREDICTED: ruBisCO large subunit-binding protein subunit alpha chloroplastic-like gi|573939233
Piper513 LCLSLKEAGLHPQASLFVELN 9311 38.42 2 2339.1925 [2] Carbamidomethyl (C)|[13] Deamidated (NQ) UBX domain-containing protein putative gi|255555707
Piper514 LDLGTSLMEKAKSK 2345 22.02 2 1519.8153 hypothetical protein CICLE_v10005101mg gi|567859134
Piper517 LFDTIDNLDYAAKK 627 14.62 2 1667.8392 [N-term] Acetyl (N-term) PREDICTED: oxygen-evolving enhancer protein 3-1 chloroplastic gi|727553557
Piper530 LGSAGSSSAMGSAMGSAMGSALGR 384 32.41 2 2173.9309 [N-term] Acetyl (N-term)|[10] Oxidation (M)|[14] Oxidation (M) CAMKK/CAMKK-META protein kinase gi|675191825
Piper531 LGSSVGNVCDIGLPK 4744 10.53 2 1458.7238 [7] Deamidated (NQ) PREDICTED: E3 ubiquitin-protein ligase RFWD3 gi|470141070
Piper532 LHPGGPFDPLGLAKDPDQAALLK 2450 23.31 2 2412.2436 [N-term] Acetyl (N-term)|[18] Deamidated (NQ) Light harvesting complex of photosystem II 5 isoform 1 gi|590602386
Piper535 LIESQETDRGDRPK 8933 21.91 2 1642.8283 PREDICTED: peptidyl-prolyl cis-trans isomerase-like gi|672203950
Piper565 LPPTLR 8656 2.23 2 695.4307 PREDICTED: protein TIC110 chloroplastic-like gi|502129546
Piper569 LRPIPIGVSADLLVGQK 8601 39.66 2 1775.0662 PREDICTED: protease Do-like 1 chloroplastic-like gi|568832203
Piper570 LRSIMNTYSK 7472 16.37 2 1227.6165 [5] Oxidation (M) PREDICTED: probable histone-lysine N-methyltransferase ATXR3 gi|727530792
Piper580 LSIRVPNLNHLASKHR 2406 15.76 2 1897.0569 [N-term] Acetyl (N-term)|[7] Deamidated (NQ) hypothetical protein PRUPE_ppa010759mg gi|596004279
Piper597 LVVADVAGLAPGTGTLTVFTNEK 6009 36.5 2 2272.2213 PREDICTED: aminomethyltransferase mitochondrial gi|659067712
Piper602 MAAMNSSVLACNYAISGTASSELSKLASVPSAVFPTVSGPK 1162 24.35 2 4117.0294 [4] Oxidation (M)|[11] Carbamidomethyl (C)|[12] Deamidated (NQ) Photosystem I reaction center subunit N, chloroplast precursor putative gi|255571379
Piper603 MAASLQAAATLMQPAKVGATGR 2402 17.35 2 2218.1033 [N-term] Acetyl (N-term)|[1] Oxidation (M)|[6] Deamidated (NQ)|[12] Oxidation (M) PREDICTED: oxygen-evolving enhancer protein 1 chloroplastic gi|743794420
Piper604 MACESGQGCGAGQGCGTNACSSENLCSKDER 5281 31.05 2 3112.1555 [3] Carbamidomethyl (C)|[13] Deamidated (NQ)|[18] Deamidated (NQ)|[24] Deamidated (NQ) predicted protein gi|168012350
Piper605 MAKGPVR 2847 23.08 2 799.4342 [N-term] Acetyl (N-term) hypothetical protein PRUPE_ppa008435mg gi|596298312
Piper607 MASASPSLLK 4064 8.09 2 1019.529 [1] Oxidation (M) hypothetical protein PHAVU_011G039100g gi|593135502
Piper608 MASLLLPPASSLLSPSSAAAASSSSSR 1545 18.17 2 2561.3078 [1] Oxidation (M) PREDICTED: probable plastid-lipid-associated protein 6 chloroplastic gi|695064427
Piper609 MIGVWGMGGVGKTTLANQVAKNAEEDKLFEK 1539 21.27 2 3364.6383 [N-term] Acetyl (N-term)|[17] Deamidated (NQ)|[22] Deamidated (NQ) PREDICTED: probable disease resistance protein At4g27220 gi|731416899
Piper611 MPAVQELVR 1681 19.21 2 1083.5669 [N-term] Acetyl (N-term) PREDICTED: stromal 70 kDa heat shock-related protein chloroplastic-like gi|695033566
Piper613 MTPQTGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDR 1423 22.2 2 3906.7776 [1] Oxidation (M)|[4] Deamidated (NQ) large subunit of Rubisco chloroplast gi|649132073
Piper615 MVSEAEKFAK 7115 18.84 2 1196.5712 [N-term] Acetyl (N-term)|[1] Oxidation (M) PREDICTED: stromal 70 kDa heat shock-related protein chloroplastic gi|743943389
Piper617 NAGAEGPAVVEK 3373 9.85 2 1141.5589 [1] Deamidated (NQ) hypothetical protein SORBIDRAFT_02g011260 gi|242043896
Piper623 NAVITVPAYFNDSQR 8971 19.12 2 1736.85 [N-term] Acetyl (N-term)|[1] Deamidated (NQ) hypothetical protein PRUPE_ppa020538mg partial gi|595812189
Piper624 NAVVTVPAYFNNSQR 4210 35.26 2 1679.8277 [11] Deamidated (NQ) PREDICTED: heat shock 70 kDa protein II-like gi|470146512
Piper626 NCAPIILR 4724 14.37 2 955.5264 [2] Carbamidomethyl (C) PREDICTED: L-ascorbate peroxidase 2, cytosolic isoform X1 gi|697132537
Piper630 NDPNAAAAVSELR 3237 18.33 2 1327.637 [4] Deamidated (NQ) PREDICTED: photosystem II repair protein PSB27-H1 chloroplastic gi|729448076
Piper635 NGITMIRNHIVSAAAAVTTQEGTIAQIIGPVCDVTFKAGNMPNIYDAVLVETK 567 22.57 2 5670.9176 [N-term] Acetyl (N-term)|[32] Carbamidomethyl (C)|[41] Oxidation (M)|[43] Deamidated (NQ) CF1 beta subunit of ATP synthase chloroplast gi|699008381
Piper637 NGYPILIIAEDIEQEALATLVVNK 8385 40.43 2 2625.4254 PREDICTED: chaperonin 60 subunit beta 2 chloroplastic gi|697177711
Piper638 NIGVLPSK 1702 41.37 2 868.5014 [N-term] Acetyl (N-term) PREDICTED: transcription factor GTE10 isoform X1 gi|802648066
Piper639 NIIHFYNLANQAVEKGAGMDGQKITYTLIK 2968 12 2 3366.7147 [11] Deamidated (NQ)|[19] Oxidation (M) hypothetical protein CICLE_v10030969mg gi|567887676
Piper649 NNAGFPHNVVFDEDEIPAGVDVSK 8043 18.94 2 2569.209 PREDICTED: plastocyanin A'/A'' gi|697132031
Piper660 NSPPDFQKTKLMTR 6739 12.33 2 1677.8369 [12] Oxidation (M) O2 evolving complex 33kD family protein gi|224094610
Piper664 NVRPDYLK 7316 21.22 2 1003.5435 superoxide dismutase [mn], putative gi|255559673
Piper675 QGPNLLK 1347 25.12 2 769.4334 [1] Deamidated (NQ) PREDICTED: photosystem I reaction center subunit II chloroplastic-like gi|672165549
Piper678 QHVSEDARSNGKGNKPMNGSPDRK 6805 14.75 2 2668.2439 [N-term] Acetyl (N-term)|[1] Deamidated (NQ)|[10] Deamidated (NQ)|[17] Oxidation (M) PREDICTED: uncharacterized protein LOC101265024 gi|460387039
Piper685 QLDYVPSTIMVLEEVVK 2894 17.08 2 1963.0016 [1] Deamidated (NQ) PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like gi|747071890
Piper691 QLVASGKPDK 5497 15.44 2 1042.5776 [1] Deamidated (NQ) PREDICTED: oxygen-evolving enhancer protein 1 chloroplastic gi|225468761
Piper694 QLYGSQAILNQQHAFPVR 3220 19.36 2 2072.0387 [10] Deamidated (NQ)|[11] Deamidated (NQ)|[12] Deamidated (NQ) hypothetical protein POPTR_0007s06770g gi|224093896
Piper698 QQLVELWMANGLISSNER 5487 18.21 2 2090.0035 [1] Deamidated (NQ)|[2] Deamidated (NQ)|[16] Deamidated (NQ) PREDICTED: disease resistance protein RGA2-like isoform X2 gi|571438506
Piper699 QRIGIGAVRRGR 2125 20.92 2 1338.7864 [1] Deamidated (NQ) PREDICTED: ferredoxin-dependent glutamate synthase chloroplastic gi|720066978
Piper704 QTTVQATGVASNLVEIIQGSGFK 7709 49.46 2 2330.2126 [N-term] Gln->pyro-Glu (N-term Q) PREDICTED: uncharacterized protein LOC103706976 gi|672131867
Piper712 RAGVFEINNSTAFASK 3491 16.93 2 1752.8792 [N-term] Acetyl (N-term) PREDICTED: uncharacterized protein LOC103439527 gi|657969188
Piper715 RATDVVVQVPNLQGGK 3922 27.58 2 1722.9157 [N-term] Acetyl (N-term)|[8] Deamidated (NQ) hypothetical protein PHYSODRAFT_353200 gi|695464043
Piper717 RDVGNEIPK 1751 11.7 2 1026.5493 PREDICTED: uncharacterized protein LOC105173773 gi|747092390
Piper720 RGNQQQGQSVSYRK 7460 15.22 2 1678.7843 [N-term] Acetyl (N-term)|[4] Deamidated (NQ)|[5] Deamidated (NQ) PREDICTED: ruBisCO large subunit-binding protein subunit alpha chloroplastic gi|729443438
Piper721 RINNVSQQQQPLPFSLDSK 2151 18.15 2 2243.1187 [N-term] Acetyl (N-term)|[3] Deamidated (NQ)|[4] Deamidated (NQ)|[7] Deamidated (NQ) PREDICTED: zinc finger protein KNUCKLES-like gi|502106795
Piper723 RNGITMIRNHIVSAAAAVTTQEGTIAQIIGPVCDVTFKAGNMPNIYDAVLVETK 228 18.1 2 5728.9317 [2] Deamidated (NQ)|[6] Oxidation (M)|[44] Deamidated (NQ) CF1 beta subunit of ATP synthase chloroplast gi|699008381
Piper726 RQQAKAYFAK 11211 35.1 2 1252.6659 [N-term] Acetyl (N-term)|[2] Deamidated (NQ) hypothetical protein SORBIDRAFT_05g002770 gi|242069981
Piper731 RVMPLR 3283 19.77 2 770.4654 PREDICTED: stromal 70 kDa heat shock-related protein chloroplastic-like gi|658008416
Piper734 SAKFAAAGTEEKSKR 10112 15.16 2 1621.8392 [N-term] Acetyl (N-term) hypothetical protein POPTR_0010s25180g gi|224113355
Piper740 SFANAPCIRLNIHKDFVSCRVAISLVK 5340 45.13 2 3001.5969 [11] Deamidated (NQ) predicted protein gi|168016236
Piper753 SKPESGEVIGVFESIQPSDTDLGAK 3957 17.68 2 2589.283 PREDICTED: oxygen-evolving enhancer protein 1 chloroplastic gi|586769243
Piper757 SLILMDLSYNRLSGPLPISIR 3324 16.6 2 2416.311 [N-term] Acetyl (N-term)|[5] Oxidation (M)|[10] Deamidated (NQ) PREDICTED: protein TOO MANY MOUTHS gi|719981575
Piper767 SSAKEIAFDQHSRRALQAGIDK 2713 13.51 2 2429.2445 [10] Deamidated (NQ)|[17] Deamidated (NQ) PREDICTED: ruBisCO large subunit-binding protein subunit alpha gi|694332515
Piper771 SSLQAGVEKLASAVGVTLGPR 5369 26.94 2 2081.1481 [N-term] Acetyl (N-term) PREDICTED: ruBisCO large subunit-binding protein subunit alpha chloroplastic-like gi|573939233
Piper772 SSSYNADGSSR 1513 14.88 2 1130.4562 [5] Deamidated (NQ) PREDICTED: protein UPSTREAM OF FLC-like gi|729344843
Piper773 STAELEEEMMAKIPK 7160 19.42 2 1763.8344 [N-term] Acetyl (N-term)|[10] Oxidation (M) PREDICTED: LOW QUALITY PROTEIN: protein TPX2 gi|657979269
Piper779 SVYEPLQTGLVAVDAMIPIGRGQR 2869 11.55 2 2586.3588 [7] Deamidated (NQ)|[16] Oxidation (M) ATP synthase CF1 alpha subunit chloroplast gi|108773075
Piper781 SYADNANALKAQLDQQK 3995 15.65 2 1920.8893 [N-term] Acetyl (N-term)|[12] Deamidated (NQ)|[16] Deamidated (NQ) PREDICTED: membrane-associated 30 kDa protein chloroplastic gi|449468854
Piper783 TAAGVQLRSSSHLTK 4518 15.07 2 1597.855 [N-term] Acetyl (N-term)|[6] Deamidated (NQ) PREDICTED: oxygen-evolving enhancer protein 1 chloroplastic-like gi|695080434
Piper789 TALQSGIDK 2172 17.48 2 931.4973 PREDICTED: ruBisCO large subunit-binding protein subunit alpha gi|449456032
Piper794 TEEGARAALAEPMKNIDGHQVTCK 8043 14.93 2 2569.209 [15] Deamidated (NQ) PREDICTED: UBP1-associated protein 2C-like gi|470115498
Piper796 TFLTSDVVVVDIKEEFIPTGAAQGMAMDNSGYPPY 4795 18.76 2 3835.7941 [N-term] Acetyl (N-term)|[25] Oxidation (M)|[27] Oxidation (M) hypothetical protein SELMODRAFT_168153 gi|302765539
Piper801 TIAECLADELINAAK 8248 11.43 2 1616.8044 [N-term] Acetyl (N-term)|[12] Deamidated (NQ) Os01g0100700 gi|115433960
Piper802 TIARPDVAEVCIQALQFEEAK 6960 44.19 2 2387.2136 [11] Carbamidomethyl (C) PREDICTED: uncharacterized protein At5g02240-like gi|657956853
Piper809 TMSFQPFLNSNNKNPNFTSPPLK 6452 17.17 2 2626.2338 [11] Deamidated (NQ)|[12] Deamidated (NQ)|[14] Deamidated (NQ)|[16] Deamidated (NQ) PREDICTED: F-box protein At5g07670-like gi|502178851
Piper820 TSDPLEEYCKDNPETDECRTYED 3003 12.98 2 2851.1102 [N-term] Acetyl (N-term)|[12] Deamidated (NQ)|[18] Carbamidomethyl (C) PREDICTED: calvin cycle protein CP12-1 chloroplastic-like gi|694998271
Piper828 TVGAGVIQK 2449 18.01 2 913.5234 [N-term] Acetyl (N-term) PREDICTED: elongation factor TuA, chloroplastic-like gi|565355181
Piper831 TVKALVSELKSMSK 5905 9.53 2 1577.8776 [N-term] Acetyl (N-term)|[12] Oxidation (M) PREDICTED: ruBisCO large subunit-binding protein subunit beta chloroplastic gi|731322356
Piper837 VAAAAAASSVAR 2063 86.58 2 1043.5717 Putative DUF21 domain-containing protein gi|703076596
Piper841 VAIMPPVPNK 6142 20.18 2 1065.5818 [9] Deamidated (NQ) PREDICTED: uncharacterized protein LOC103437671 gi|657965456
Piper843 VAITISPR 54 26.78 2 855.5175 ATP-dependent clp protease ATP-binding subunit clpA family protein gi|224136316
Piper850 VDLNVPLDDNFNITDDTR 1044 17.86 2 2075.9413 [10] Deamidated (NQ) cytosolic phosphoglycerate kinase family protein gi|224109062
Piper879 VISAGMNPVQIARGIDK 3138 20.25 2 1811.9486 [N-term] Acetyl (N-term)|[7] Deamidated (NQ)|[10] Deamidated (NQ) Chaperonin 60 subunit beta 4 gi|703081381
Piper880 VKKAIIGK 1468 3.29 2 897.6019 [N-term] Acetyl (N-term) PREDICTED: calponin homology domain-containing protein DDB_G0272472-like isoform X gi|694324955
Piper881 VKVGNEVVR 2521 24 2 999.5705 [5] Deamidated (NQ) huntingtin interacting protein putative gi|255558564
Piper883 VLDLSNVCLTR 1758 19.73 2 1274.649 [N-term] Acetyl (N-term)|[6] Deamidated (NQ) PREDICTED: probable disease resistance protein At4g27220 gi|731416899
Piper917 VTAICVMGGLGK 863 21.44 2 1163.617 [7] Oxidation (M) hypothetical protein ARALYDRAFT_474150 gi|297847358
Piper932 VVGVDTSGEGVK 6963 36.94 2 1145.5927 PREDICTED: dihydrolipoyl dehydrogenase 1 mitochondrial gi|719988361
Piper935 VVMALNISQIPNVTK 4732 16.89 2 1626.8838 [12] Deamidated (NQ) PREDICTED: probable disease resistance protein At4g27220 gi|731416899
Piper949 YAVFGYVTENEDYLADLK 10802 26.6 2 2108.9911 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP38 chloroplastic-like gi|743926702
Piper950 YEKVGTIK 5284 3.87 2 936.5389 cytochrome b5 domain-containing family protein gi|224134737
Piper951 YFCTAAPQPWLFVGLGNPGNK 1674 11.64 2 2281.1133 [8] Deamidated (NQ)|[17] Deamidated (NQ) hypothetical protein PRUPE_ppa011211mg gi|595829406
Piper953 YIHGDLKPSNILIGQDMEPK 650 20.12 2 2309.1842 [N-term] Acetyl (N-term) hypothetical protein ARALYDRAFT_484030 gi|297817706
Piper955 YMALTELQER 3084 14.91 2 1295.6144 [N-term] Acetyl (N-term)|[8] Deamidated (NQ) hypothetical protein PRUPE_ppa003142mg gi|595817464
Piper972 GICVPIRCPGSMRQIGTCLGAQVK 1173 10.45 2 2602.2562 [N-term] Acetyl|[8] Carbamidomethyl|[12] Oxidation|[22] Deamidated Ar-AMP Leaf AP00401
Piper973 GICVPIRCPGSMRQIGTCLGAQVK 1173 10.45 2 2602.2562 [N-term] Acetyl|[12] Oxidation|[18] Carbamidomethyl|[22] Deamidated Ar-AMP Leaf AP00401
Piper974 QIGTCLGAQVKCCR 4669 10.1 2 1649.7805 [5] Carbamidomethyl|[12] Carbamidomethyl|[13] Carbamidomethyl Ar-AMP Leaf AP00401
Piper977 CAPKMKQIGTCGMPQVKCCK 287 10.63 2 2226.0018 [5] Oxidation|[11] Carbamidomethyl Floral defensin-like protein 2 (PhD2) Leaf AP01597
Piper978 CAPKMKQIGTCGMPQVKCCK 287 14.64 2 2226.0018 [11] Carbamidomethyl|[13] Oxidation Floral defensin-like protein 2 (PhD2) Leaf AP01597
Piper979 SVSCLRNK 10008 15.09 2 963.4762 [4] Carbamidomethyl|[7] Deamidated Floral defensin-like protein 2 (PhD2) Leaf AP01597
Piper988 SCCRSTQARNIYNAPR 4653 22.56 2 1897.8383 [2] Carbamidomethyl|[7] Deamidated|[10] Deamidated Pp-AMP1 Leaf AP01585
Piper989 SCCRSTQARNIYNAPR 4653 22.56 2 1897.8383 [3] Carbamidomethyl|[7] Deamidated|[10] Deamidated Pp-AMP1 Leaf AP01585
Piper992 GQVNDSACAANCLSLGKAGGHCEK 979 21.12 2 2332.0176 Gamma-2-purothionin Leaf AP00226
Piper995 NKGICVPIR 9157 17.77 2 998.5754 Antifungal protein AX1 Leaf AP00235
Piper996 GIKDWIK 4947 15.31 2 900.5037 [N-term] Acetyl Rc-LTP C (CB-C) Leaf AP01220
Piper997 ALGTLLK 2017 12.19 2 756.4833 [N-term] Acetyl thionin Osthi1 Leaf AP00909